SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1V2YTC3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V2YTC3
Domain Number 1 Region: 215-408
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.09e-73
Family B3/B4 domain of PheRS, PheT 0.00000536
Further Details:      
 
Domain Number 2 Region: 44-199
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.37e-42
Family Myf domain 0.0046
Further Details:      
 
Domain Number 3 Region: 480-700
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.09e-33
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00091
Further Details:      
 
Domain Number 4 Region: 708-806
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 5.75e-30
Family Anticodon-binding domain of PheRS 0.001
Further Details:      
 
Domain Number 5 Region: 417-488
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000101
Family Domains B1 and B5 of PheRS-beta, PheT 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V2YTC3
Sequence length 806
Comment (tr|A0A1V2YTC3|A0A1V2YTC3_9FLAO) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome OX=996 OS=Flavobacterium columnare. GN=BZL53_01490 OC=Flavobacteriaceae; Flavobacterium.
Sequence
MKISYNWLKQFIKTDWSSEKTAELLTDLGLEVEGVEKFFSIKGGLEGLIVGHVLTCEKHP
NADKLKITTVDLGNGEPVQIVCGASNVAVGQKVIVATIGTKLYDKEGNSFEIKKGKIRGE
ESHGMICAEDEIGIGDSHEGIMVLDESIEVGTLASKVFNVEIDEVFEIGLTPNRADAMSH
WGVARDLRAGMLQQDISTELITPSVSSYKVEKRTLKIDVNVENTTLVPRYCGVTISDIKV
GTSPAWLQNRLKAIGLTPKNNIVDITNYVLHELGQPLHAFDASKIHGKIIVKNATEGEKF
ITLDDVERSLHKEDIMICDEKGPLCIAGVMGGKKSGVSERTTSIFLESAYFNPVSVRKTA
KRHGINSDASFRFERGIDPTITEYALKRAAILICQIAGGEMTSDIMEVYPKKIEDFPVFL
NLEKVKKIIGQEIPDEEIKNILVSLDIKVNSISKVGLGLTVPAYRVDVTREIDVIEEILR
VYGYNNIQFSQKLNATTAHSSKTEDYKVQNIVANLLVGNGFNEMMANSLTSPNYVNLSNS
LHEKNNVLMLNPLSNDLSAMRQSMLFSALEAVSFNINRKNADLRLFEFGKTYHKQLAGHE
EKMHLTLTMSGNRSKESWTNAQRPSDFFQFKGYILNIFERLGIKNIVTMPMKSDIFSEGM
IYELGASSLVEFGTIKKSILKHFDIKQEVFFADFNWNAILKHLSTNVKFIEISKYPEVRR
DLALLVDEHIEFEKILDLANKTEKNLLKRVDLFDVYQGNNLPEGKKSYAISFLLQDSTKT
LTDSQIDKVMSKLTQNFETELGATLR
Download sequence
Identical sequences A0A1V2YTC3 G8XAA6
gi|365960190|ref|YP_004941757.1| WP_014165242.1.48360 WP_014165242.1.49381 WP_014165242.1.70420 WP_014165242.1.85295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]