SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1V4D943 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4D943
Domain Number 1 Region: 7-274
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-78
Family Protein kinases, catalytic subunit 0.0000000292
Further Details:      
 
Domain Number 2 Region: 518-578
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000353
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Domain Number 3 Region: 452-511
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000798
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V4D943
Sequence length 668
Comment (tr|A0A1V4D943|A0A1V4D943_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:OPF82033.1} KW=Complete proteome; Reference proteome OX=1507734 OS=Streptomyces antioxidans. GN=VT50_0207910 OC=Streptomyces.
Sequence
MEEPRRLGGRYELGSVLGRGGMAEVYLAHDTRLGRTVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYVDGVSIPYIVMEYVDGSTLRELLHSGRKLLPERSLEMTI
GILQALEYSHRNNIVHRDIKPANVMLTRSGQVKVMDFGIARAMGDAGMTMTQTAAVIGTA
QYLSPEQAKGETVDARSDLYSTGCLLYELLTVRPPFVGDSPVAVAYQHVREEPQPPSTYD
PEITPEMDAIVLRALVKDPDYRYQSADEMRADIEATLEGRPVAATAALGAVGYGSDDQPT
AMLRPQSSGAGAQTSMLPPMREDDGGFGYDERPDRGRGRGGPDKKSNLSTILLIIAGILV
LVGAIFIGKSLFAGGKNDDMVQVPNLVGKTFEDAKSQGENGDFKVKNVGSRFCEKAEKNT
VCEQTPKSGSEVKRYGTVELTMSKGPKPAARVEVPDVLNVQYESAKQQLEAKGFNVEQKT
EQSDQTAGKVIDQDPKGGKKVAKGTTVTLTVAKAQENVVVPDVTTKKVEDATKSLEGKGL
KVQTQEADNGDVEAGTVTDQNPKGGQEVPPGSTITLIVAKAPADGDNVPVPNLGGKKLNE
AKKALQDLGLNVGNIAGPQDDNATVVASQPGAGTQVPKGQSVNLITVGGQGGNGGGDNGG
IIGGQNGF
Download sequence
Identical sequences A0A1V4D943
WP_046088790.1.4450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]