SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1V4JFD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4JFD6
Domain Number 1 Region: 671-818
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.14e-41
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 999-1098
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.4e-30
Family Ras-binding domain, RBD 0.00086
Further Details:      
 
Domain Number 3 Region: 213-346
Classification Level Classification E-value
Superfamily PH domain-like 1.93e-22
Family Phosphotyrosine-binding domain (PTB) 0.02
Further Details:      
 
Domain Number 4 Region: 4-85
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-19
Family PDZ domain 0.011
Further Details:      
 
Domain Number 5 Region: 944-1013
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000258
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V4JFD6
Sequence length 1566
Comment (tr|A0A1V4JFD6|A0A1V4JFD6_PATFA) Regulator of G-protein signaling 12 isoform A {ECO:0000313|EMBL:OPJ70856.1} KW=Complete proteome; Reference proteome OX=372326 OS=Patagioenas fasciata monilis. GN=AV530_017209 OC=Patagioenas.
Sequence
MHAPPRIRSVEVARGRAGYGFTLSGQAPCVLSCVMKGSPADYVGLKAGDQIFAVNEINVK
KASHEDVVKLIGKCSGVLHMVIAEGISHIDSCSSDEEVGFYDGKGWLKPKPDSKALGINR
AEKVVEEMQSGGIFNMIFENPTLCAGSSDHSAPKQRSFSDSAAIKFEAGHESVSYPNLLS
KEEIAKVLNDDSVFRIGLEGAEDFGLDASILNVAMIVGYLGSIELPSTTSNLENESLQAI
RGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKSGVVAEYPAEKLAFSAVCPDDRRFFGLV
TMQTNDDASLAQDAEGALRTSCHVFMVDPELFHHKIHQGIARRFGLECTADPDTNGCLEF
PTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSNSDSGIGNFNQEEKN
NRVLVVDLGTNPSKHIPNSIWENPVGRGHNQPASHWNGFCHEQEGNIPLEVIQNDKSQNV
SKHLSPSARIEVPLVSSRNSIPPSKKNAAGAGNQRWLPVHVLQEWQHGNVSDQESYTDST
DGWSSVNCGTLPPPMNKIPADRYRVDGSFGQPQLKSHKNEWSKKMFCMQNKFGPPHSIRK
SKEDKKGAKFGHPMGLSQAPPPRSSVRRSFGRSKRFSITRSLDDLESATVSDGELNSTDL
KDCISENSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPIGVKYFSDFLRKEFSEE
NILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTPVNIDSQAQLADDILNSPHP
DMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRPLPDPQRVPSSPTSKHSISSE
KSNISTPKKLSGKSKSGRSLNEESGEEDTEKKKRGTFFSWSRSKSLGKSQKRKENGDYPN
DSIQSNGLSYRRESQGSMSSTASLDLSETSRLPAFVPDKEKSPKYCCINLPDGSSSKMAV
KSGFSIKEVLSGLCEKHGINIAAVDLFLVGGDKPLVLHQDSSILESRDLRLEKRTLFRLD
LVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLNELVARLNGEQEPLDLGVPISNLDGQR
VVLDEKEPTKGRAFTDKQKGASVKQSATVTTSRNQVSTGEGRTLGKSNSIKMKGENGKNA
REVRLSKREDSIAKIGKKKCQKINLDEAEEFFELISKAQSNRADDQRGLLRKEDLILPDF
LRLPPTGPEPSSSTPAGPKGLNRRVSKSEGKDGCTSPSGKQESVQNFNENSVKKMGYSEN
KHKSALTALHSQKTFSVPFNTALSPIPHAQENNATIWKRQSRELQAEGIQMVDDENVADL
TLVAEGDISSPNSTLLPPPPPTPPSDTSELPEANYPPPTPFAGANHRKKKDSQETSGNSC
KQMSHKAKSSRTFNPPGVRENPGTELPVNRIIDVDGVKLEDTSTRSCDDSEGNLSFEVYI
SELSTTNLGQEEAQNMSSLAHKCLQKMEIYANFLSGMVEGFITRVYQIYFPERNGAQQHI
TMTGTGDGDIALPCLKTTRSAGYDQMPLDVCFPLSNEGETHFPPSPGREFSVRSLIAKLI
AVYQST
Download sequence
Identical sequences A0A1V4JFD6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]