SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1V4JNG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4JNG7
Domain Number 1 Region: 30-290
Classification Level Classification E-value
Superfamily YWTD domain 6.15e-56
Family YWTD domain 0.00000205
Further Details:      
 
Domain Number 2 Region: 642-897
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-55
Family YWTD domain 0.00000508
Further Details:      
 
Domain Number 3 Region: 341-571
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-49
Family YWTD domain 0.00000231
Further Details:      
 
Domain Number 4 Region: 944-1203
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-38
Family YWTD domain 0.0000588
Further Details:      
 
Domain Number 5 Region: 1334-1369
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1255-1295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 7 Region: 900-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000375
Family EGF-type module 0.039
Further Details:      
 
Domain Number 8 Region: 1296-1331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 597-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000794
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 295-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000004
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 11 Region: 1212-1265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000014
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1V4JNG7
Sequence length 1620
Comment (tr|A0A1V4JNG7|A0A1V4JNG7_PATFA) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=372326 OS=Patagioenas fasciata monilis. GN=AV530_013196 OC=Patagioenas.
Sequence
MEAAAPLLLLLRLLAASVLRCEPGSAGASPFLLFANRRDVRLVDAGGTKLESTVVVSGLE
DAAAVDFQYSQGIVFWTDVSEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLY
WTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDS
STRKIIVDSDIYWPNGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGTLTHPFAL
TLSGDTLYWTDWQTRSIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPHFHTPCEESN
GGCSHLCLLSPRDPFYSCACPTGVQLEDDGRTCKSGAEEVLLLARRTDLRRISLDMPDFT
DIILQIDNIRHAIAIDYDPVEGYIYWTDDDVRAIRRAYLDGSGAQTLVTTEINHPDGIAV
DWVARNLYWTDTGTDRIEVTRLNGTSRKILISENLDEPRAIVLNPIMGYMYWTDWGESPK
IECAYLDGSERRVLVNTSLGWPNGLALDLEKDKLYWGDAKTDKIEVINVDGTMRKTLLED
KLPHIFGFTLLGDYIYWTDWQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKVFGTN
SCAESNGGCSHLCFFTPQETRCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETN
NNDVAIPLTGVKEASALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGM
AVDWMGRNLYWADTGTNRIEVARLDGQHRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGK
PRIVRAYMDGTNSITLVDKVGRANDLTIDYADQRLYWTDLDTSMIESSNMLGQEREIIAD
DLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGL
NDCVQNNGHCGHLCLAIPNGFRCGCAAHYTLDPNSRNCSSPASFLLFSQKSAISRMIPDD
QRSPDIILPMHGLRSVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQPFTVMSTPNQSQN
PEKQPHDLSIDIYSHTLYWTCEATNSVNVHRLNGESIGMVLRGDHDKPRAIVVNAERGYM
YFTNMQDRAPKIERAALDGTEREVLFTTGLIRPVALVIDNKLGKLFWVDADLKRIESCDL
SGANRVTLEDSNILQPMGLTVLGNHLYWIDRQQQMIERVEKINGYKRTRIQGRIAHLTGI
HAVEELDMEEFSVHPCSHDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSP
DQFTCATGEIDCIPMAWRCDGFPECDDQSDEDNCPICSASQYQCEKGQCIDVHLRCNGEV
DCQDKSDEADCDTICLPNQFRCASGQCILLKQQCDSFPDCIDGSDELMCEKTKPASDEAQ
PHSSAIGPVIGIILSLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPG
SSQHGTFTGISCGKSVISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPP
PSPATDRSLYNAEMFYSSNIPSTTRSYRYSSDKRSYLIRGIAPPTTPCSTDVCDSDYTTS
RWKANKYYIDLNSDSDPYPPPPTPRSQYLSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A1V4JNG7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]