SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1V4K8J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4K8J6
Domain Number 1 Region: 616-871
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-56
Family YWTD domain 0.00000312
Further Details:      
 
Domain Number 2 Region: 5-264
Classification Level Classification E-value
Superfamily YWTD domain 4.97e-54
Family YWTD domain 0.00000152
Further Details:      
 
Domain Number 3 Region: 315-550
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-49
Family YWTD domain 0.00000317
Further Details:      
 
Domain Number 4 Region: 919-1178
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-40
Family YWTD domain 0.0000407
Further Details:      
 
Domain Number 5 Region: 873-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000398
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1309-1347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000126
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1231-1269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 571-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000216
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 9 Region: 1271-1307
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 267-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000311
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 11 Region: 1188-1241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000493
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V4K8J6
Sequence length 1596
Comment (tr|A0A1V4K8J6|A0A1V4K8J6_PATFA) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=372326 OS=Patagioenas fasciata monilis. GN=AV530_010941 OC=Patagioenas.
Sequence
MRAAPLLLYANRRDLRLVDAANGKENATVIVGGLEDAAAVDFVFVKGLIYWSDVSEEAIK
RTEFNKSGSVQNVVISGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQE
LDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSSRSIIVNTDIYWPNGLTLDYEEAKL
YWADAKLNFIHKSNLDGSHRQAVVKGSLPHPFALTLFGDTLYWTDWNTHSILACSKYSGE
DLREIHSNIFSPMDIHAFSQKRQPNATNPCGINNGGCSHLCLMSPTKPSYQCACPTGVKL
LENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLPLEDIRHAIAIDFDPLEGYIYW
TDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTM
RKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRIVLVNTSLGWPNGLA
LDYAEGKIYWGDAKTDKIEVMNADGTGRRVLVEDKLPHIFGFTLLGDYVYWTDWQRRSIE
RVHKRTAEREIIIDQLPDLMGLKATNVHQIIGTNPCAEDNGGCSHLCLYRPQGLRCACPI
GLELINDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRI
YWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVAKLDG
QHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGTERTTLVPNVGRANGL
TIDYAKRRLYWTDLDTNLIESSNMLGLDREIIADDLPHPFGLTQYQDYIYWTDWSRRSIE
RANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPIGGFVCGC
PAHYSLNSDNRTCSAPTTFLLFSQKNAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLD
KQLYWIDSRQNIIRKAQEDGSQSLTVVTSPVPNQNLDMQPYDLSIDIYSRYIYWTCEATN
VINVTRLDGRPVGVVLKGDQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVL
FFSGLSKPIALAIDSQLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENW
LYWIDRQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKQLNIQEYRQHPCSQDNGGCSH
ICIVKGDGTTRCSCPIHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTEC
EDHSDEKNCPVCSDTQFQCESGQCIESALRCNGEANCQDNSDEKNCEVLCLNDQFRCASG
QCIGKSKKCDHNLDCSDSSDEQGCYTTEEPAPQPNNTIGSIIGVILTVFVVGAMYFICQR
VLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSVISSLSIMGGSS
GPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEFGYSSNSPSTHRSYS
YRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVTAATAKGYTSDLNYDSEPVPPPPTPRSQY
LSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A1V4K8J6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]