SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1V4PBK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V4PBK4
Domain Number 1 Region: 3-304
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.27e-88
Family G proteins 0.0000000523
Further Details:      
 
Domain Number 2 Region: 282-363
Classification Level Classification E-value
Superfamily TGS-like 8.5e-37
Family G domain-linked domain 0.0000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V4PBK4
Sequence length 366
Comment (tr|A0A1V4PBK4|A0A1V4PBK4_9BACI) Ribosome-binding ATPase YchF {ECO:0000256|HAMAP-Rule:MF_00944} KW=Complete proteome OX=1954237 OS=Geobacillus sp. LEMMY01. GN=B1A75_04545 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MGLTAGIVGLPNVGKSTLFNAITKAGAESANYPFCTIEPNVGVVEVPDERLDVLTEMFRP
KRTVPTVFEFTDIAGIVKGASKGEGLGNKFLSHIRQVDAICQVVRCFSDENITHVAGKVD
PLADIETINLELVLADLETIDKRIERVGKIAKQKDKEAAFEYDILRRLKETLEDGKPART
LEFTDEEMKVVKQLHLLTIKPMLYVANVGEEDIADPSGNPFVKDVREFAKRDNAEVIVVC
AKIEEEIAEFSDEEKRQFLQELGIEQSGLDQLIRAAYSLLGLATFFTAGEQEVRAWTFRK
GMKAPQCAGIIHSDFERGFIRAETVSYDDLVAAGSMAAAREAGKVRLEGKDYEVQDGDIM
HFRFNV
Download sequence
Identical sequences A0A063YY63 A0A1C3D6S9 A0A1V4PBK4 A0A1V9BWE7 A0A2H5KME0 Q5KU68
WP_011232946.1.100150 WP_011232946.1.19233 WP_011232946.1.2219 WP_011232946.1.22479 WP_011232946.1.25743 WP_011232946.1.3446 WP_011232946.1.60903 WP_011232946.1.6497 WP_011232946.1.70239 WP_011232946.1.78869 WP_011232946.1.8599 WP_011232946.1.90668 WP_011232946.1.91533 WP_011232946.1.93593 235909.GK3483 gi|56422018|ref|YP_149336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]