SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1V5SVH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V5SVH3
Domain Number 1 Region: 12-110,157-203
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 0.0000000051
Family Isochorismatase-like hydrolases 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V5SVH3
Sequence length 229
Comment (tr|A0A1V5SVH3|A0A1V5SVH3_9EURY) Isochorismatase family protein {ECO:0000313|EMBL:OQA58536.1} OX=1852878 OS=Euryarchaeota archaeon ADurb.Bin294. GN=BWY45_01126 OC=Archaea; Euryarchaeota.
Sequence
MSIKKPVRILQIGDMQKGFTIKNGNLYVSGAEDILGPAQEFLEKIPKSAFDYTFVILDTH
FSEEYEESEEAKEFPIHCEYQTDDWELSLDVSGLPDTWYLMKNQFTMWGERKGQAISFTN
PDRKIAYESLFHFVDDPRHPGQVIPRDSFLHSIAPEHDLANIEVTLFGVASDFCNRFAME
GWLARGAKVTIIKDLTKGIHKETASVLGECSYQRYMPDRLSAISSQELL
Download sequence
Identical sequences A0A1V5SVH3 Q2FTF2
323259.Mhun_2656 WP_011449609.1.85653 gi|88603894|ref|YP_504072.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]