SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1V9BY03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9BY03
Domain Number 1 Region: 12-178
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.45e-20
Family Shikimate kinase (AroK) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V9BY03
Sequence length 188
Comment (tr|A0A1V9BY03|A0A1V9BY03_9BACI) Shikimate kinase {ECO:0000256|HAMAP-Rule:MF_00109} KW=Complete proteome OX=33938 OS=Geobacillus thermocatenulatus. GN=B1692_04335 OC=Geobacillus thermoleovorans group.
Sequence
MSRQTTIPLRERNIILIGFMGAGKTTIGQLVAKKLYRDFIDVDAEIERRQGMSIPELFAQ
KGEAYFRKVERELIVDLCTNTRLKILSLGGGAYLQEDVRRACLAHGIVFFLDLSWEHWKE
ERLPLIVDSRPVLKNKTLEEVEQLFFQRQSAYALHHSRVVLNELEAEQAAEQIVESIKWT
WDVYEPNR
Download sequence
Identical sequences A0A143MHC9 A0A1D7NCG1 A0A1V9BY03 Q5KY95 T0NNU0
WP_011231542.1.100150 WP_011231542.1.2219 WP_011231542.1.45808 WP_011231542.1.46395 WP_011231542.1.6497 WP_011231542.1.70239 WP_011231542.1.93963 WP_011231542.1.97756 235909.GK2056 gi|56420591|ref|YP_147909.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]