SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1V9BZI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9BZI0
Domain Number 1 Region: 2-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2e-55
Family ABC transporter ATPase domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1V9BZI0
Sequence length 265
Comment (tr|A0A1V9BZI0|A0A1V9BZI0_9BACI) ABC transporter ATP-binding protein {ECO:0000313|EMBL:OQP14747.1} KW=Complete proteome OX=33938 OS=Geobacillus thermocatenulatus. GN=B1692_02280 OC=Geobacillus thermoleovorans group.
Sequence
MLELKRITKVFNEGTADEKIALRGIDLTLAPGDFVTVIGSNGAGKSTLMNIISGRLSPDT
GEVWINGCDVTALKEHARARYIGRVFQDPMAGTAPHMTIEENLALAYNRTKRRTLSLGVT
KQKREWFRETLRTLHLGLEDRLAAKVGLLSGGERQALSLLMATFTKPDVLLLDEHTAALD
PARAELVTELTKQIVEQHRLTTLMVTHNMEQAIRLGNRLIMMDGGQIIFAAEGKEKEELT
VERLLEAFQRIRGSQFASDRAVLSS
Download sequence
Identical sequences A0A063YZI9 A0A1C3DA34 A0A1V9BZI0 A0A2H5KGN5 Q5L274 V6VES4
235909.GK0671 WP_011230174.1.100150 WP_011230174.1.19233 WP_011230174.1.2219 WP_011230174.1.22479 WP_011230174.1.25743 WP_011230174.1.45808 WP_011230174.1.60903 WP_011230174.1.62042 WP_011230174.1.6497 WP_011230174.1.70239 WP_011230174.1.78869 WP_011230174.1.8599 WP_011230174.1.90668 WP_011230174.1.91533 WP_011230174.1.93593 gi|56419206|ref|YP_146524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]