SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1V9C3T5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1V9C3T5
Domain Number 1 Region: 1-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.85e-45
Family Nucleotide and nucleoside kinases 0.0000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1V9C3T5
Sequence length 201
Comment (tr|A0A1V9C3T5|A0A1V9C3T5_9BACI) Dephosphocoenzyme A kinase {ECO:0000256|HAMAP-Rule:MF_00376} KW=Complete proteome OX=33938 OS=Geobacillus thermocatenulatus. GN=B1693_08960 OC=Geobacillus thermoleovorans group.
Sequence
MTLTIGLTGGIASGKSTVSAMMRELGLPVIDADEAARAVVRPGEDAYRQIVAAFGPGILQ
TNGEIDRAKLGAIVFNNEEERKKLNAIVHPAVRQKMLAEKEALVRSGTKTVVLDIPLLFE
SGLTSWVDKVLVVYVDDDIQLRRLMERNGFTEEEARARICAQWPLAEKMKRADAVINNNG
TREETRRQLLAILKQWDALEK
Download sequence
Identical sequences A0A1V9C3T5 Q5KWC4
235909.GK2727 WP_011232201.1.2219 WP_011232201.1.38928 gi|56421262|ref|YP_148580.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]