SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1W4X7P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W4X7P2
Domain Number 1 Region: 763-887
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.13e-39
Family Regulator of G-protein signaling, RGS 0.0000559
Further Details:      
 
Domain Number 2 Region: 7-93
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-20
Family PDZ domain 0.006
Further Details:      
 
Domain Number 3 Region: 1049-1138
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-18
Family Ras-binding domain, RBD 0.0038
Further Details:      
 
Domain Number 4 Region: 203-335
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000193
Family Phosphotyrosine-binding domain (PTB) 0.019
Further Details:      
 
Domain Number 5 Region: 993-1061
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000425
Family Ras-binding domain, RBD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W4X7P2
Sequence length 1436
Comment (tr|A0A1W4X7P2|A0A1W4X7P2_AGRPL) regulator of G-protein signaling loco isoform X1 {ECO:0000313|RefSeq:XP_018328423.1} KW=Complete proteome; Reference proteome OX=224129 OS=Agrilus planipennis (Emerald ash borer) (Agrilus marcopoli). GN=LOC108739168 OC=Elateriformia; Buprestoidea; Buprestidae; Agrilinae; Agrilus.
Sequence
MHPSRRRKKRPNYGIRTAEVIRGPNGFGFTISGQQPCILSCIVANSPADQAGLRAGDFLI
SVNGTPVSKSTHDAVVNLIGSSIGPIRMTIAENYYSDSSDEENEMPRLVNNRKPRYLHKP
KGHRHKSEVNKCTDDFKINSPVKKLSKSNDHANDRFQQNQSCASERNSTEPYCEWNANFL
NKVNLPRPVANDYNEGAVEYKALVGYLGTIEMPKQLLPNSRLQTVCSCIKKLRQEKRTPT
LILMTILPSCLTLKNASNQILAIYPLNRVVYISSTTDKDTRYFGLVTSAVCNNNSTETVN
DEAALCKDSVMNKADIEISNSCHVFLTDPKLGDHCAHLQKADQFKITCTKDVITGNCLEF
PRSALYIVSLVQNLYKLQDSVNDRAIINGHLHPGGRLNDDLLPLVANSPQPSASSNSDSG
IGYRDDCGNVSDRILIVEFPVPKKLPLASNVSNNNRPSAIDATSICLDVLDDPLNNGNTA
SSHIKGINSIESIRCINNIEVSMPVNNLAKIINTETQVNETKIDGHFRENMLNNIRALEG
GCGQHQFTDDIKANSNIDGAQEIETSEYRFVADNEYYEDYDCDSASRFSVRAMPDPKTFS
MNNLQNHAKCGMEFYSERAVDVPLDKKSYESVSLHSVDEELSSVENVSVHSLRTTDKIFK
VPDSLYLSNKTYNRNQLKIVGSYDTLTSDKHNNSFMKYKLSPKVYSTSKQNCSCEEISKL
ETVEMCSYSSLQNLCSWNNGADVRFDSMAMDDENGLRKNERPEGPSAWATSFEKLLEDTV
GLQTFAAFLKKEFSAENIYFWTACERYRRNPSVSERATEAQKIYKRHLCLGAPEPVNVDS
QGRQITEQSLQEARCSLFDQAQKQIFNLMKFDSYPRFLKSDLYKQCLAGNADVNFDDGLL
IYPTSVTPTKLKKSLSNAEDRRRKSLLPWHRKNRSKSKDRGETEYNLKKDTGTSNDLTHR
LGRSEIHNSKTSLISQESGKFLPDDSSLTCRNPLCRVILNNGSTTVVQIKKDETIQELIN
RVLEKRGIVYSCYEVFTDKHSKPLDVREPSTTLSGCEVKIEQRVIFKLYLPNKKVIAVKS
KYTKILMDVLKPILCKYDYKLDNVNITVGKDFVDVYQPVTSVEEKRLIVQLKNGQMMELG
QKIDDKPNNIPSLETVTNRVFKDILNEKGDTRCSKPKSDQGSLKSDGWGSENSSSIFGKL
LKKEPSEIYEKRKKQNAMCSKSEQVHSCEDESYETNTMIKRPLIAKWKTGAKLHLPSPES
DVSFSELYEGLKRAQRSRLEDQRGTEINFELPDFLKAKTNDRLDFSSSVKQTSVNTKLHI
NNNGAFNNSNNNNNNNSNNNNKKPNNFRIYSPNKLSPSISSSPLKCSNEKLTEVSEKSTE
SFSNASPRPSEPPPLPPKPKIVPAKPSNWGQNGLVKYIQKTDNSNLYLEQPTSSFV
Download sequence
Identical sequences A0A1W4X7P2
XP_018328423.1.13287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]