SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1W5A623 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5A623
Domain Number 1 Region: 640-895
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-56
Family YWTD domain 0.00000366
Further Details:      
 
Domain Number 2 Region: 22-288
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-51
Family YWTD domain 0.00000262
Further Details:      
 
Domain Number 3 Region: 339-586
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-51
Family YWTD domain 0.00000212
Further Details:      
 
Domain Number 4 Region: 942-1200
Classification Level Classification E-value
Superfamily YWTD domain 8.11e-36
Family YWTD domain 0.000061
Further Details:      
 
Domain Number 5 Region: 1252-1292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 6 Region: 1293-1328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 897-945
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000173
Family EGF-type module 0.043
Further Details:      
 
Domain Number 8 Region: 1331-1369
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000589
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 9 Region: 596-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000069
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 10 Region: 293-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 11 Region: 1211-1262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000285
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5A623
Sequence length 1612
Comment (tr|A0A1W5A623|A0A1W5A623_9TELE) low-density lipoprotein receptor-related protein 5-like isoform X1 {ECO:0000313|RefSeq:XP_018608191.1} KW=Complete proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=LOC108934668 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MEVRVAGWLLCGAVLCAVRGSPLLLFANRRDVRLVDVEGGRAESTVVVSGLDVVAVDFVF
SEGLIFWTDVSEEAIKQTYYDQSSSAVKEATLGSGRTVLAGLDSPDGLACDWLGHKLYWT
DSETNRIEVANMNGSFRKVLFWQDLDQPRAIALNPAHRYMYWTDWGEEPRIERAGMDGSN
RQIIVESNIFWPNGLTIDLEEQKLYWADAKLTFIHRANLDGSLREAVVEGTLTHPFALTL
SGDTLYWTDWQTRSIHACNKETGDKRREVLSGLHSPMDIQVLDKDRQPNVSTPCSHGNGG
CSHLCLLSPMEPFYSCACPTGVRLQDDGKTCRPGAEEVLLLARRTDLRRISLDLPDFTDI
VLQVDDIRNAIAIDYDPVDGHVYWTDDEAKGIRRARIDGSEAQTLVTTEIDHPDGIAVDW
VARNLYWTDTGPDHIEVTRLNGTSRRILVSENLDEPRAIALDPVRGYMYWTDWGAKPKIE
RACLDGSQRVVLINSSLGWPNGLALDYEAGKLYWGDARTNKIEVININGTDRRTILDDKL
PHIFGFTLLGDYIYWTDWQRRSIERVRKTGAAREMIIDQLPDLMGLKATSVTKAFGTNAC
AVDDGGCSHLCLYRPQGPQCACPMGLELLSDLSTCVVPEAFLLFTHRANIRSISLGTNGN
NVAIPLTGVKEASALDFDVAENRIYWTDISTKTISRAFMNGSSVEHVIEFGLDYPEGMAV
DWMGRNIYWADTGTNRIEVARLDGQYRQVLVCKDLDNPRALALDPANGYMYWTEWGGKPR
IARAYMDGHNITTLVDKVGRANGLTIDHMDQRMYWTDLDTCMIESSDMLGQQRATVADDL
PHPFGLTQYRDYIYWTDWNLRSIVRADKRSGLNRTLIQGQLDYVMDILVFHASRQSGSNE
CSHGNGQCAHLCLATPEGSRCRCASHYSLDPNGKNCISPSSFLLFSQKASISRMVLGEQS
LDIILPIHVMRNVRVIRYDPLERFIYWVDGRQNIRRARDDGSESFVVVSNTPGQQQNLEK
QPHDFSLDPYSRSLFWTCEITNTINAHRLDGVFVGVILKDDVDKPRAIVVNAERGYMYFT
TVQEHSAKIERASLDGTERESLFTTGLIRPVALTLDNQLGKLFWADADLKRIESSDFSGA
NRITLQDSNILQPVGLTVLGEHLYWIDRQQQMIERVDKLTGEKRTRIQGRIVHLTSIYAV
EDVDPEEFASHPCYLDNGGCSHICIAKGDGTPRCSCPMHLVLLQNLLTCGEPPTCSTEQF
TCATGEIVCIPMVWRCDGLAECDDNSDEENCPLCTVHQFQCDKGQCIDAHLRCNGEADCA
DNSDEQDCDTVCLPSQFHCGKNQCIEKKQQCDSYMDCADNSDELFCDMLTAPPRIYQADS
STVGPVIGIILSVFVMGGMYFVCQRVVCLWYKRPSGAFPHEYISGTPHVPLNFIDPGSSQ
HSTFAGITCEKSMMSSPSLMGSSNSGAPLYDRTHVTGASSSSSSSSKAAFYPQMLNPPPS
PATDRSLYNVELFYSSNSPSTIRSYRPYLMRGVAPPTTPCSTDVCDSDYAPSRWKSNKYN
MDLNSDSDPYPPPPTPRSQYLSAEESCPPSPSTEHSYFHLGPPPPSPCTDSS
Download sequence
Identical sequences A0A1W5A623
XP_018608191.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]