SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1W5A9K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5A9K1
Domain Number 1 Region: 566-695,726-797
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.92e-37
Family Hemopexin-like domain 0.00098
Further Details:      
 
Domain Number 2 Region: 75-116
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000785
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 34-73
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000379
Family Somatomedin B domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5A9K1
Sequence length 798
Comment (tr|A0A1W5A9K1|A0A1W5A9K1_9TELE) proteoglycan 4 isoform X2 {ECO:0000313|RefSeq:XP_018609650.1} KW=Complete proteome OX=113540 OS=Scleropages formosus (Asian bonytongue). GN=prg4 OC=Osteoglossomorpha; Osteoglossiformes; Osteoglossidae; Scleropages.
Sequence
MLLSFFHQRTEMVCSGTLFSVVLLACFLPFCSGQASCTNRCGETYFRGHVCHCDYDCLIH
DECCKDYERTCTTSDSCKGRCGETFKRGRQCNCDPECTRYNQCCPDYEAHCGKVTTTRAP
ATTIPTYKNPKKDKPTEPPKKIPTEKPAMKGPVHTKGPQPEETDSRDQDFSVDGFIMTTH
FPPPNQQELQEQGDEAIDNVTPEVLGQLAEVYSSGPTISLDNMSGNEPLQTDLPEDASPQ
ESISPSFNPPASETEEEVMEQMEIPLLRNQSFNDTGNGQVSAVFSASGSPTQISATTPNR
FYSHDLQEQGVAEPANSDIKLTAEGEASSLNSKPTGQTPQGLEEVTPLSQEDSPSSTKST
MQDLPSSKPSKEGVASENQISEKLHVPEAPLTTAVTDKPKAKCTGERTPSPRLASNNSAL
TDSPESMSTDHSKWSPTPDQSSALGGPSPSTVLNGAKDDVCDTSSDTSPTVATGKEVLSP
RTDAYAMFEAGDITSTAFPQPTTPGLVPEPTVMAPQDKAESQMPLSRVTTTAPISKPVQP
VQTDDTNAMSTANPPEYLADDNNDTNLCSGRPINGLTTLRNGTIVVFRGHYFWMLDANRV
PGPARGITEVWGIPSPIDTVFTRCNCQHKTYFFKGYRYWRFENDVMDPGYPKTISDGFSR
LSGRITAALSVPQNSRRPESVFFFKRGGLMQRYSYQHGTSPNCGKKTKYMVVTARNRKAR
QAEDGLHKEIKITWKGFPSFVTSAISIPTPMMTEGYDYYVFSRTKYYNIKIDGNTLALAS
PVTAASQQNSAKSFFKCP
Download sequence
Identical sequences A0A1W5A9K1
XP_018609650.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]