SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1W5CHC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CHC7
Domain Number 1 Region: 18-121
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.49e-25
Family Anti-sigma factor antagonist SpoIIaa 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CHC7
Sequence length 133
Comment (tr|A0A1W5CHC7|A0A1W5CHC7_9NOST) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_15485 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MSFLAFVELAIYLVKFMTLTQEPQVVLFKPQGSIDLQGGLALTEQMTQAGSQPHQLWVLD
LAEVDFMDSSGLVSLVKGLTSARQLGCRLILCNVQTPVRLILELTQLDSVFEIFDSYEEI
LTLVNDSSFALVS
Download sequence
Identical sequences A0A1W5CHC7 Q3MBE4
240292.Ava_2070 gi|75908291|ref|YP_322587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]