SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1W5CLZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5CLZ2
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily RbcX-like 9.81e-44
Family RbcX-like 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CLZ2
Sequence length 132
Comment (tr|A0A1W5CLZ2|A0A1W5CLZ2_9NOST) Chaperonin family protein RbcX {ECO:0000313|EMBL:OBQ09887.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_07210 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MNLKQIAKDTAKTLQSYLTYQALMTVLAQLGETNPPLALWLHTFSVGKVQDGEAYVKELF
REQPDLALRIMTVREHIAEEVAEFLPEMVRSGIQQANMEQRRQHLERMTHLSLSNPSPES
EQQTISDTDWDH
Download sequence
Identical sequences A0A1W5CLZ2 A0A1Z4KTZ8 O86418 Q3M675 Q798D4
2005405532 gi|17229017|ref|NP_485565.1| 359436 NsR16 gi|75910110|ref|YP_324406.1| WP_010995694.1.33676 103690.alr1525 240292.Ava_3906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]