SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1W5CMS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1W5CMS9
Domain Number - Region: 30-99
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0196
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CMS9
Sequence length 172
Comment (tr|A0A1W5CMS9|A0A1W5CMS9_9NOST) Uncharacterized protein {ECO:0000313|EMBL:OBQ10342.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_06300 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MMNWFSINWHAIFVPSISILELVIRGSLVYLALFSVLRLLPSRQMGTLGITDLLVVVLFA
EAAQNAMASNYTSITEGAILVGTVIFWSYFLNWLGYKLPIVQRFLNPPPLLLVKNGKTIE
RHLQRELITEDELKSKLRQQGVEFLADVKLAYMEADGSISIITSESKLVARE
Download sequence
Identical sequences A0A1W5CMS9 Q3M7M0
gi|75909615|ref|YP_323911.1| 2005405683 240292.Ava_3409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]