SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1W5CNP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1W5CNP0
Domain Number - Region: 12-92
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.00549
Family GSPII protein E N-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1W5CNP0
Sequence length 95
Comment (tr|A0A1W5CNP0|A0A1W5CNP0_9NOST) Uncharacterized protein {ECO:0000313|EMBL:OBQ11164.1} OX=1710890 OS=Anabaena sp. 39858. GN=AN489_04765 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Anabaena.
Sequence
MSLINHQSNSQRLTEIVKTLIDNNHLYQENLNKQEMIAMINRTFDPSVVPDLESISEEEL
TKRIKSILSLNLVSGMLNDLTPEQMQIFDESVRRG
Download sequence
Identical sequences A0A1W5CNP0 Q3M705
gi|75909830|ref|YP_324126.1| 2005405859 2005406070 240292.Ava_3625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]