SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1W5D2E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1W5D2E6
Domain Number 1 Region: 30-332
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.1e-52
Family beta-glycanases 0.012
Further Details:      
 
Domain Number 2 Region: 571-757
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 1.15e-36
Family Ran-binding protein mog1p 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1W5D2E6
Sequence length 760
Comment (tr|A0A1W5D2E6|A0A1W5D2E6_9LECA) 1,3-beta-glucanosyltransferase {ECO:0000256|RuleBase:RU361209} KW=Complete proteome; Reference proteome OX=136370 OS=Umbilicaria pustulata. GN= OC=Umbilicariaceae; Umbilicaria.
Sequence
MKAFAVASTALAAATFFAASAVAATSADPIVIKGSKFFYKTNGTEFFIKGIAYQQDVGGN
GSTTVGSSTFTDPLADPVGCKRDIPLLQQLSTNTIRVYAINASQDHSQCMQMLQDAGIYL
IADLSQPTISINRDTPQWNDEVYKQYTSVVDALQNYTNVLGFFAGNEVANSVNTTGASAF
VKAAVRDMKAYIKQQNYRAIGVGYATADVSDIRIQLADYFNCGPAADAIDFWGYNIYSWC
GNSSYSLSGYETRTEEFANYTVPAFFAEYGCNTVEPRDFTEVAALFGPDMTSVWSGGIVY
EYFQEANNYGLVQINGDTASKLPDFTAYSSQIAMVTPSAVNSASYTATNTVARACPTTGV
AWEAATALPPTPNQQLCSCMLPALSCIAKPNSNDTAVESLFAEVCGLVQGVCDGITANGT
TGVYGAYSVCNGTEQLSWAFNAYYQNQKGTQNNDACDFNGAATTQAAASPTGSCSSLISQ
AGSAGTGTVTSVPSGTGSGSGSSSSGKATATKKGAAGMVTVPSFSFGMLSLGVYVMAAAM
YNPTPSVLEKAEEPRDSCSTKERKKQSMDVHFKHTELFGGAIVVDLPEGFRDVSTIRQVP
DNQEVYLDAAGFTSIIFDITERVRDVATDDEALRFHLHDIVESGDGVRVWRSGAVECEKL
PPSTPTLHLVATLPSPPRPSSTAPAPTLILLSLLLIRFAAQDSDIVVTINVPFVPGSYDA
EDVDFDKGKWGRLGEVAEKIRERVVGSFEVREWGLFGEGE
Download sequence
Identical sequences A0A1W5D2E6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]