SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1X6X1D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X6X1D6
Domain Number 1 Region: 62-291
Classification Level Classification E-value
Superfamily MetI-like 1.44e-53
Family MetI-like 0.0000792
Further Details:      
 
Weak hits

Sequence:  A0A1X6X1D6
Domain Number - Region: 17-62
Classification Level Classification E-value
Superfamily MalF N-terminal region-like 0.0017
Family MalF N-terminal region-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X6X1D6
Sequence length 303
Comment (tr|A0A1X6X1D6|A0A1X6X1D6_9MICO) N-Acetyl-D-glucosamine ABC transport system, permease protein 1 {ECO:0000313|EMBL:SLM92254.1} OX=43669 OS=Brachybacterium faecium. GN=FM106_04700 OC=Brachybacterium.
Sequence
MSHDTAPAAPRRARSRDGVWPLVFLAPLMIGVAVFYFWPILATFLNSFSSFGPFGGRSFA
GLDNYRALLTDSFIPRAVLNTAVYTAIVLLGIPIAVAVASLMNQKGLRFSRFYQVLFFLP
AVSMPVAVALVWRMIFNKEFGIVNWALSLVGIDGPYWTTAPWWALLAVSIVGLWSSLPLA
IIILSAGLQAIPAELYEAAQLDGAGTMRQFIAVTVPLLTPSIFFLTIITAINGFQLFDLL
FAMMGDANPAMADTQSLVYLFYSEAFRQNDQGYASVIALLILLIIGVFTLLQFRMQKRWV
HYE
Download sequence
Identical sequences A0A1X6X1D6 C7MI67
446465.Bfae_06280 gi|257067828|ref|YP_003154083.1| YP_003154083.1.138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]