SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1X6XAG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X6XAG1
Domain Number 1 Region: 20-210
Classification Level Classification E-value
Superfamily MetI-like 7.46e-37
Family MetI-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X6XAG1
Sequence length 219
Comment (tr|A0A1X6XAG1|A0A1X6XAG1_9MICO) Probable amino acid ABC transporter integral membrane protein {ECO:0000313|EMBL:SLM96129.1} OX=43669 OS=Brachybacterium faecium. GN=FM106_10845 OC=Brachybacterium.
Sequence
MTPNTSWWDWDHAAAVLPKLLLEGFKVTLIATVLGTLIALVLGLMVAIIRRSAPKLLSTP
FTWVVEFIRMTPLVVQLVFANLVLSPYVDSTLVIGIWVLGIHYTTYMAEVYRAGIDSVPT
GQWEAATALSLPRVRTWRAVVVPQAIRNTLPALGNYAISMFKETPFFVVIYIPELVRVAQ
QYGSSYFRYTEAITLAGLIFLAASYPTSLLIRRLEKKLA
Download sequence
Identical sequences A0A1X6XAG1 C7M9P0
YP_003154174.1.138 gi|257067919|ref|YP_003154174.1| 446465.Bfae_07280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]