SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1X6XHB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X6XHB3
Domain Number 1 Region: 111-299
Classification Level Classification E-value
Superfamily MetI-like 6.41e-22
Family MetI-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1X6XHB3
Sequence length 318
Comment (tr|A0A1X6XHB3|A0A1X6XHB3_9MICO) Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1) {ECO:0000313|EMBL:SLM98536.1} OX=43669 OS=Brachybacterium faecium. GN=FM106_16110 OC=Brachybacterium.
Sequence
MRSDAAPTRRPRSEHWVAPLEETPLQAVDAADTSTAPRSLWAEAGHSLVRNPVFVVSALL
ILFVLFVAAFPQVFTSQDPRYADLTTANQPPGAGHPFGTSRLGYDIMARTFWGARTSVVI
GFFAMIGSTLIGGTIGALAGYLGGWFDEVISRVTDVFFAIPLILGAIVVYTRLGEMNLWT
VIAVLSVFGWTNVARIMRGAVISTKSQDFVTSSIALGASSPTVLLKHVIPNAIAPVIVTA
TVNLGVFIVAEATLSFLGVGLPTSAVSWGGDISAARDALRTQPSMLFYPSVALAVTVLSF
IMLGDAVRDALDPKARKR
Download sequence
Identical sequences A0A1X6XHB3 C7MBI2
YP_003154545.1.138 446465.Bfae_11070 gi|257068290|ref|YP_003154545.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]