SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1X6XKM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1X6XKM5
Domain Number - Region: 23-68
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 0.0628
Family MPP-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1X6XKM5
Sequence length 162
Comment (tr|A0A1X6XKM5|A0A1X6XKM5_9MICO) Uncharacterized protein {ECO:0000313|EMBL:SLM99529.1} OX=43669 OS=Brachybacterium faecium. GN=FM106_17510 OC=Brachybacterium.
Sequence
MNRTMPRRHGASALAGTDARALRRRLALLDQDQADLERARELLRQGRLLAAEDPREAFEL
VHRAALRGAGVLVARANRERRRALPLNVWLALERLGGQDAERAESLAPLVAERMRLDRNA
AARPDPELLSTHLAQTSAHLDLVAERLLEDLPTHLTDLAEAG
Download sequence
Identical sequences A0A1X6XKM5 C7MBE4
gi|257068252|ref|YP_003154507.1| YP_003154507.1.138 446465.Bfae_10690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]