SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1X6XXE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X6XXE4
Domain Number 1 Region: 26-299
Classification Level Classification E-value
Superfamily MetI-like 7.38e-63
Family MetI-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1X6XXE4
Sequence length 299
Comment (tr|A0A1X6XXE4|A0A1X6XXE4_9MICO) Putative sugar ABC transporter, permease component {ECO:0000313|EMBL:SLN03740.1} OX=43669 OS=Brachybacterium faecium. GN=FM106_26475 OC=Brachybacterium.
Sequence
MTTLTPVPGSTAAADPARSADRSQARRGLVARLVTQLCVIVGVLLSIFPFYWLVVMSTST
TAEIFGYPPKLTFGSSFLENVQGVFQSVDLLGSLLNTIIVSTACAVLVMFFDSLAAFAFA
KFDFPGKKALFVLLIATMLVPGSLSLVPSFILMSSLGWVGTLKALIIPGAANAFGIFLLR
QMASGSIPDELVDSARIDGAGFFTMYRRVAVPLLRGGLAFLGIFTFITAWNDYVWPLIIL
VDPERQTLQTALQNLNSVYLTDYGMVMAGALISVVPLIGVFIIGARHFIANIAAGAIKG
Download sequence
Identical sequences A0A1X6XXE4 C7MDT9
YP_003155336.1.138 446465.Bfae_19300 gi|257069081|ref|YP_003155336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]