SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1X6Y073 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X6Y073
Domain Number 1 Region: 318-492
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.95e-36
Family Histidine kinase 0.0017
Further Details:      
 
Domain Number 2 Region: 253-327
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.24e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0033
Further Details:      
 
Domain Number 3 Region: 196-243
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000000798
Family HAMP domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1X6Y073
Sequence length 529
Comment (tr|A0A1X6Y073|A0A1X6Y073_9MICO) Osmosensitive K+ channel histidine kinase KdpD {ECO:0000313|EMBL:SLN04912.1} OX=43669 OS=Brachybacterium faecium. GN=FM106_29205 OC=Brachybacterium.
Sequence
MALPSLRTERPVSLWTRIVALISLLLVLGTVVTGSLSLFLLNRTLIQSVDNNLQSGMGEM
LALAQHELAGDDAIQNSTYTPVEYAIEIRDAQGRSIEQAVVHYGPGSVSLPFPDLTDEQI
LHRGGRPFTVLDSAENRWRVVAMLNSGPEGGSVYVALPLTGVDRTMHEMALIIVLVGTLV
VLVGMGLGGYVTHRSLEPLRDVEATASQIAGGDLSRRVPVTRTSLEVHDLALSLNEMLVR
IEQSFAAQSASEERATLSEAKMRRFVGDASHELRTPLAAIRGFGELYRMGALPTDEDVSS
AMRRIEDEARRMGSLVENLLRLARLDEKPELDLAPVDFTDALFDAAQDLRALDPGRQVMV
TSLSGTPLSVQPHVSIGVLGDEASLRQVILNLVGNANRHTPKGSPVEIAVGYTPQGTARI
EVRDHGEGIDDDQREKVFERFYRTDASRARSATQGGGAGLGLSIAASIVQQHRGSIGVTE
TEGGGATFWVELQGTEIAPEQQVEPDQRRALGAEPDDAAPPTPEDPAQG
Download sequence
Identical sequences A0A1X6Y073 C7M9V1
446465.Bfae_07900 YP_003154235.1.138 gi|257067980|ref|YP_003154235.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]