SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1X7T0B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1X7T0B1
Domain Number 1 Region: 348-514
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000646
Family RecA protein-like (ATPase-domain) 0.061
Further Details:      
 
Domain Number 2 Region: 1080-1212
Classification Level Classification E-value
Superfamily RNI-like 0.000000255
Family 28-residue LRR 0.01
Further Details:      
 
Weak hits

Sequence:  A0A1X7T0B1
Domain Number - Region: 193-264
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00235
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0073
Further Details:      
 
Domain Number - Region: 914-1025
Classification Level Classification E-value
Superfamily RNI-like 0.0149
Family 28-residue LRR 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1X7T0B1
Sequence length 1333
Comment (tr|A0A1X7T0B1|A0A1X7T0B1_AMPQE) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:Aqu2.1.07885_001} KW=Complete proteome; Reference proteome OX=400682 OS=Amphimedon queenslandica (Sponge). GN= OC=Haplosclerida; Niphatidae; Amphimedon.
Sequence
MIDVSQWRASIGLWNYCQAASSRPANGHHSHSFKAAVDSKSGSTTSGEKTFKLPAALSLI
ALLLLLFLSLSLLRHILMIPPTGNCYQVQYTTGVTVTDTNYLQSVVLPGGSSSNLIYNDL
CLIVCLRMLLLLSGDVELNPGPITDKELTKAAVMKIFDSSAHHYMLIGNGLNVNVSDLMP
IPGAASTNLNFVFQRWFDADKDVNWDRLIKLCDDFLDKLGKAKSNLLEYIGQSIPDNVSS
HTVLPLPVDDISNTPVTNIRGQSDVAKPISSIPDDVQGYADNMRQHYKHQPIVATDWPPR
IGKHFFGRLALVEKQDSTTQAESAWHLLRGQVDKTVKLTENKEISVEDVLQPTDSSLSLR
VVIDGPPGIGKTTLCRKLLNMWSNGPLVHQQYDLVLYCPLRNSKIATAATLADLFEYKSS
KVSKVVDWLLDGDGEGLLIMFDGWDELSEQLRRSSLAASIIHRKQLHKCSVIVTSRSYAS
SSLLKMDTLSRHVQVIGFSEEEISTVIIQTLQKDAKLAQELIDKKREDDENEEPFTTTQS
SKDSQLAVKLINDLEVRNDVQSLCYVPLVCSMVILVYCKEGGHLPTTLTQLYENFILQTI
RRHVEIKPRHHTDPYTLGSLSSLPSQLAKPLQEMCQLAYTNLANTTMTFSSHQLQSLSEA
VKEDYLGLMTRFTEYDEEKYQFLHLSIQEFLAAWWIANHEKKREEVFKDHFDNDHFRMCL
RFVAGLTHLEHESYQQYFNKQQLDLQCKREPLFGFETCHLSYFYQNPEIRLSEYDHISSD
DFDNVPILLVQLLYESQNTTLCQVLAQSINNHSLCLDRVSLSLFDWLCLSYCINNSNTTW
NHLHLGVSNQSLSVFTAGITNNSLQTQCKRLEVWLDGPTDESIHKLLQPSLLYNIQECYC
ELILGQYVPCLVLLQFLNLPQLKILHLIMDDSTIPTVDNTYYTDKCTELEKCIEMNSTLQ
EMKIDLDGFQEITSTIISVIRGVTRNKTITSLTIDVGTPPPPPLPDGVIEQLLKDNNTLQ
ALSLDIYAKHQISLNITPLTALVIGRWNNKLMKSSLLLHIKGLHCLILHDPYPPHLLFLS
HPSLHTLTLPLDTAESAIELFTILQTNTTLKALSVEIKEERVYTSSMGTSLQDMLTQNQT
LKYLEISSSYRDSIFGPEDIPSSFLSFLTTGLRHNTSLQQLSVSIPLNEEIRTFINVISQ
KNNLTELKVNFKPDQSLYSNCSYEKKEQIMIPLFYEQGLPAVTNMLQSHTTIRLLRIVCL
YINYESSQPNWIELVQHLYETIFIHLSLEYIEIKVGIITPPLLEDTLKDQKKTLMDRHRK
EQPHKTLPIVKID
Download sequence
Identical sequences A0A1X7T0B1
Aqu1.205319|PACid:15703847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]