SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Y1LPZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y1LPZ6
Domain Number 1 Region: 118-164
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000245
Family VPS37 C-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y1LPZ6
Sequence length 230
Comment (tr|A0A1Y1LPZ6|A0A1Y1LPZ6_PHOPY) Uncharacterized protein {ECO:0000313|EMBL:JAV75732.1} OX=7054 OS=Photinus pyralis (Common eastern firefly) (Lampyris pyralis). GN= OC=Elateriformia; Elateroidea; Lampyridae; Lampyrinae; Photinus.
Sequence
MSLAVFQADSKRALGSLSNLTNDQLDEYINNEEKIESLLQGLNQSYLQEIEQEKETLLAS
NSSLSEFNLTREPALIEGRERVEKLSADGEEIYKTVEEKMNEIREKTGDMSLETALALLQ
TAASETEEESDKLTSQFLSNEIELDQFLEEFIEKRIVMHTRLIKAEKMAKILSSDPILNN
VPSYVNAPPVNINSNYFPGINPNSAPNVPYPIGGISMPMPGNINYFQNHY
Download sequence
Identical sequences A0A1Y1LPZ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]