SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Y2HHS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2HHS4
Domain Number 1 Region: 121-435,517-570
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.04e-67
Family GABA-aminotransferase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2HHS4
Sequence length 582
Comment (tr|A0A1Y2HHS4|A0A1Y2HHS4_9FUNG) Pyridoxal phosphate-dependent transferase {ECO:0000313|EMBL:ORZ34148.1} KW=Complete proteome; Reference proteome OX=765915 OS=Catenaria anguillulae PL171. GN=BCR44DRAFT_38994 OC=Blastocladiales; Catenariaceae; Catenaria.
Sequence
MSNSTSTMNTLTDLYPHLIHASARAAELWAKVPGSHVVSLYIRNSYQNDPARVVLELLLF
FFAIKYLLSNRYSPRKDTIKLSEREIDELVDDWVPEPLVPGETDPVADRRNLDEVASIPV
LTSGGGAKVKVEGSNRVVLNLASFDVFGLANSERIKDKAIVALRKYGVGACNPPGFYGTM
DVHMQLERDIARFIGADHAILYAQGFSAISSVVPAFSKRGDLVVVDEGVAFALQKGFQIS
RSKIVFFKHNDMNDLEHKLATIAAEDKRLKRPLYRKFILVEGIYTNSGDIAPLPKLVELK
ERFKYRLIVEESCSFGVLGANGRGITEHFGIPATKVDMLVGSLATSVGASGGFCAGSLPI
IDHQRLSASSYCFSAALPPMLAVAASEGLAYIEKEAPRIMPAMQANIRVIRDILAQVPCF
ELLSSPESPLQHVRVARETLPFTFDPVDGLLDSESSFNTTNSTMSPRTGVLSLLGGSRAN
SRNANNNRPVALTGGPRRAEDVESIRLEQESRFLQDIVKESLENGVLVTRAKYNAEQEHA
CPRPSLKIVVPSDLTRKEAEQAAKVVKAAATKVIQAWAKARK
Download sequence
Identical sequences A0A1Y2HHS4
jgi|Catan1|38994|fgenesh1_kg.51_#_9_#_Locus4133v1rpkm40.66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]