SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Y2XGI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y2XGI7
Domain Number 1 Region: 210-590
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.23e-95
Family GABA-aminotransferase-like 0.00000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Y2XGI7
Sequence length 652
Comment (tr|A0A1Y2XGI7|A0A1Y2XGI7_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:OTB20817.1} OX=1001832 OS=Daldinia sp. EC12. GN=K445DRAFT_18085 OC=Sordariomycetes; Xylariomycetidae; Xylariales; Hypoxylaceae; Daldinia.
Sequence
MPHTEKTGERRPSQSRGNRLSQLFSSSPKANQQPSAQQALMAMQNGSSPSITASGLALPT
ISLSTATAGEPNQDEPPTTLFQPPSSTEISRQKRFDAQFGPLVDPTDRYVSKHHGEPLEA
PIIDEPPYYYVLTTYISYLLLLALGHIRDFFGKRFSKKQTYKTLRVANGYAPLNDDFDSF
YTRRLKMRIDDCFARTSTGVPGRYINVLNRVSDDFNETYRYTGGATETLNMSSYNYLGFA
QSEGPCANAVEECVKRYGLSFCSPRADSGTSDLVCEVEKEIASFVGKPAAMVFSMGFVTN
ASSFPALVSKGCLIISDELNHASIRLGARLSGAVIRSFKHNDMLDLEKKLREAIAQGQPR
THRPWKKILVAVEGLYSMEGTMCDLPGILNLKDIYKFALYVDEAHSIGALGPKGRGVCDY
FGIDPSRVDILMGTLTKSFGANGGYIAAEKHIIEKLKSTNSATMLGESPTPAVLMQILAS
LKIISGELVPGQGEERLQRIAFNSRYLRLGLKRLGLIVYGHDDSPIIPVTLYNPAKISAF
SHEMLKRRISVVVVGYPATPLISSRARFCVSAAHNKDDMDRLLAACDEVGDILQLKFSTG
IAGGLKPLPEDVLEKEKIGQGAKGPKLVIEPPRWSLEEVIARGSEDAKMRLR
Download sequence
Identical sequences A0A1Y2XGI7
jgi|DalEC12_1|18085|gm1.693_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]