SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Y4IFD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y4IFD0
Domain Number 1 Region: 8-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-83
Family Protein kinases, catalytic subunit 0.00000122
Further Details:      
 
Domain Number 2 Region: 402-463
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000126
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0095
Further Details:      
 
Domain Number 3 Region: 487-549
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000366
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Y4IFD0
Sequence length 708
Comment (tr|A0A1Y4IFD0|A0A1Y4IFD0_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:OUP19004.1} KW=Complete proteome; Reference proteome OX=1965583 OS=Lachnoclostridium sp. An196. GN=B5F29_09400 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MIKIGTIVGDRYEILEKIGVGGMAEVYKGKDHKLNRFVAVKVLKEEFRSNDAFVKKFKEE
AQAAAGLAHPNIVNVYDVGDENGIYYIVMELVEGITLKEYIERKGRLTIKEATSIAIQVS
AGLEVAHNNQIVHRDIKPQNIIISREGKVKVTDFGIAKATTSQTTTSNAMGSVHYASPEQ
ARGGYVDHRSDIYSLGIVLYEMVTGRVPFDGDTAVAVAVKHLQEEMVPPSVYCKEIPYSL
EQIIKKCTQKSPDRRYQDIGDLLVDLKQSLLDPEGDFVKMVDLDEQAKTVVMDKDSSSRV
KERRKIRLAEEEYDEDEDEDDEYDDEDDDDEDDDEEGLSPSVERAMTIAGVVLAVIIVLV
LVLFASRALGLGGGNRNNSEDSQQTEENAEDEEDSQSSANTVEMPNLIGKTMTEARIELD
ELGLSITLGGSEDSSEYSAGQIIRQSVESGERVEVGSSVEVTIAGSGSGSGSSSQTSEQQ
EEEEDQAVVPNVTGRTEAEARSMLEAAGLKVGTVSESASDTVTTGNVISQSLSANTEVAQ
GTTVNLVLSSGPNKVSVTDVIGHESTRAQGELQADGFAVNVNEVYSDEVREGLVISTNPD
RGTYVEPGSTVTITVSLGRAQVEIPSVTVNMNYEAAAEALRDAGFEGTIKEATESSESVG
EGYVTRYEPRSTVDPDGTVTIYVSTGSASQQTTTQDPASQQSQTTTQP
Download sequence
Identical sequences A0A1Y4IFD0
WP_087154381.1.7251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]