SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Y4RRS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Y4RRS2
Domain Number 1 Region: 9-274
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-83
Family Protein kinases, catalytic subunit 0.00000145
Further Details:      
 
Domain Number 2 Region: 429-490
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Domain Number 3 Region: 499-560
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000051
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Y4RRS2
Sequence length 817
Comment (tr|A0A1Y4RRS2|A0A1Y4RRS2_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:OUQ20315.1} KW=Complete proteome OX=1965560 OS=Lachnoclostridium sp. An138. GN=B5E82_02295 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MVRIGMFLGDRYEILEKIGSGGMAEVFKGKDHKLNRFVAVKVLKDEFVEDRNFVRKFKEE
AQAAAALAHPNIVNVYDVGDEQNINYIVMELVEGITLKTYIEKKGRLTVKEATSIAIQVA
SGLEVAHNNQIVHRDIKPQNIIISREGKVKVTDFGIAKSVSSNTNTADAMGSVHYTSPEQ
ARGGYSDAKSDIYSLGIVMYEMVTGRVPFDGETTVVVAVKHLQEDIVSPRVYASDIPVSL
EHIILKCTEKSPDRRYANVTELIADLKQSLLTPDVNFVKEVVPDGAKTVAITRDEISRIK
RETGRIPQDEDDAESRYAYLDHMNDGEDDDDDYDDEYDDDEYDDDDYDDDEYDPDDEDDD
KDDDEDDDEEGGILDPKLEKIMMIGGIAAGVIIVIIIIVILVQVFGGRGGSGSSDNNSEN
TEIEDVLEENVEVPNLLGKSYAEAKEALNELGLGIDVGETRSSDEYEAGQIISQSVDAGT
EVEAHTTIVVDICGDGSEIEVPDLEGKSQTQAESSLTALGLSADISESYSDDVASGRVIS
TSPSAGEKVAKGSVVKVVISKGSEADAQVAVPTLTNRTESEAKSLLSAAGLGSGSVSQEY
SDTVAEGYIISQNPSAGSMVDKGTNVSYVVSRGQENVYIGNAEKDGSSESAVTNYLTGKG
LKVSRSEAYSDTVPKGNVISYNPGNGSTVAPGSTVNIVVSLGPEPVKTAQVPGAGADVNE
ITNRGFVVGNRTYEYSDSIAKDKIISCSPSGTQNVGTTINVVISRGVCLHPNVDASGKCT
ECGKTGLTPTNPTTPSEPTTPSDGSESSSGTGGQTGT
Download sequence
Identical sequences A0A1Y4RRS2
WP_087305796.1.87470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]