SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Z4GHS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1Z4GHS2
Domain Number - Region: 19-74
Classification Level Classification E-value
Superfamily EspE N-terminal domain-like 0.000139
Family GSPII protein E N-terminal domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Z4GHS2
Sequence length 80
Comment (tr|A0A1Z4GHS2|A0A1Z4GHS2_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:BAY17040.1} OX=1085406 OS=Anabaenopsis circularis NIES-21. GN=NIES21_28740 OC=Bacteria; Cyanobacteria; Nostocales; Aphanizomenonaceae; Anabaenopsis.
Sequence
MVNRYMTIQTKQGGELQMSPSTYSRLIHFLQEDLSISAASLAVALRHREQDPGPLPMILW
QYGLITMEQLEQIYDWLETV
Download sequence
Identical sequences A0A1Z4GHS2 A0A2H6LFJ6 K9QCM2
gi|427707602|ref|YP_007049979.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]