SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z8S644 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z8S644
Domain Number 1 Region: 121-205
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.5e-23
Family Middle domain of MutM-like DNA repair proteins 0.0041
Further Details:      
 
Domain Number 2 Region: 2-123
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.15e-20
Family N-terminal domain of MutM-like DNA repair proteins 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Z8S644
Sequence length 264
Comment (tr|A0A1Z8S644|A0A1Z8S644_9PROT) Uncharacterized protein {ECO:0000313|EMBL:OUU17946.1} KW=Complete proteome; Reference proteome OX=1986638 OS=Candidatus Endolissoclinum sp. TMED37. GN=CBB97_21720 OC=Rhodospirillaceae; Candidatus Endolissoclinum.
Sequence
MPEGHTIHRAAREHRRIFAKCTLKVESPQGRFSHGASILDGQLCLTVEAFGKHLLYRFNN
HLTLHVHLGLFGRIRKQKLPLQEPRGAVRVRLIGKTHAVDINGPTICRILDSNAATALIN
RIGPDVLRSDSNPDIAFAKITKSKTPIGQLIMNQSVMAGIGNIYRSEILWRQSIHPETPG
REISRETFDQLWADAKALLKIGVKHNAIITVEDAQPSKTKYRERVNIFAKKRCPSCKSEI
RCFEISGRRAFVCDICQVKETKYQ
Download sequence
Identical sequences A0A1Z8S644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]