SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1Z9T3J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Z9T3J8
Domain Number 1 Region: 3-141
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 5.76e-17
Family N-terminal domain of MutM-like DNA repair proteins 0.001
Further Details:      
 
Domain Number 2 Region: 138-226
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.5e-16
Family Middle domain of MutM-like DNA repair proteins 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Z9T3J8
Sequence length 276
Comment (tr|A0A1Z9T3J8|A0A1Z9T3J8_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:OUX35545.1} KW=Complete proteome; Reference proteome OX=1986622 OS=Actinobacteria bacterium TMED270. GN=CBE30_00095 OC=Bacteria; Actinobacteria.
Sequence
MLELPELETVRRDLDREVGGLKIKEIDVIGAKRLIPGQANKTGLTKALSGRKISSVTRVG
MLLCLQVGNGQSLVINLGPGGSLQRAANKDDQESDTQLIIGFTQKGQLRLVDSDKSATVV
LVDNEEMEEVFPEITEFGFDPVDEPISWTDFGGRLLERNTKLRPLLMDQTFIVGLGPVYS
DEILHAALLRHDRIANELITQEIRRLYRAIVETIHNAVKHRGVSLDGGSDIFGEVGGYDE
YLEVYGRGGERSRNGRGNVLTARVGGTTHYYCDYQV
Download sequence
Identical sequences A0A0C1RFU0 A0A1Z9T3J8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]