SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A202G7T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A202G7T7
Domain Number 1 Region: 3-116
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.15e-34
Family Ribosomal protein S13 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A202G7T7
Sequence length 121
Comment (tr|A0A202G7T7|A0A202G7T7_CLALS) Putative mitochondrial 37S ribosomal protein {ECO:0000313|EMBL:OVF08751.1} KW=Complete proteome OX=36911 OS=Clavispora lusitaniae (Candida lusitaniae). GN=A9F13_07g02244 OC=Saccharomycetes; Saccharomycetales; Metschnikowiaceae; Clavispora.
Sequence
MGVHIFGKSIKHNALVRIGLAKRIFGVGYTTAQQICAKVGIYPRMRMNQLTEPQIMAINK
ELSDLTIEGHLKQRILENIQQKKEIGSYAGNRHAAGLPVRGQRTRNNASTAKRLNRLDRK
L
Download sequence
Identical sequences A0A202G7T7 C4Y4R7
CLUT_02639 XP_002617195.1.3285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]