SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A222SYP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A222SYP3
Domain Number 1 Region: 7-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-78
Family Protein kinases, catalytic subunit 0.000000031
Further Details:      
 
Domain Number 2 Region: 517-578
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 452-511
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000563
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A222SYP3
Sequence length 670
Comment (tr|A0A222SYP3|A0A222SYP3_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:ASQ95792.1} OX=1851167 OS=Streptomyces sp. 11-1-2. GN=CGL27_24440 OC=Streptomyces.
Sequence
MEEPRRLGGRYELGSVLGRGGMAEVYLAHDTRLGRTVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYVDGVSIPYIVMEYVDGSTLRELLHSGRKLLPERSLEMTT
GILQALEYSHRNNIVHRDIKPANVMLTRDGQVKVMDFGIARAMGDAGMTMTQTAAVIGTA
QYLSPEQAKGETVDARSDLYSTGCLLYELLTVRPPFVGDSPVAVAYQHVREDPQPPSTYD
PEITPEMDAIVLRALVKDPDYRYQSADEMRADIEAALEGQPVAATAALGAVGYGSDDQPT
AMLRPQNSGAGAQTSMLPPMREDDGGFGYDERPDRGRGRGGSGKKSNLSTILLIVAGILV
LVGAIFIGKSLFGGGKNDDMVPVPNLVGKTIADAKSQGENGDFKIKNVGSKFCENADKDT
VCEQTPESGGEVKRYGVVELTMSKGPKPAARVEVPDVLNVQYASAKGQLEAKGFKVEQKT
QQSDQTAGKVIDQDPKGGKKVAKGATITLTVAEAQQKVVVPDVTTQKVADATAALEGKGL
KVQTQEVDNGDAEAGTVTDQTPKGGQEVLPGSTVTLTVAKAAAENVPVPNLGGQKLKDAK
KALQDLGLNVGNIAGPQDDEATVVASQPGAGTQVPKGQSVNLITVAGQGNGGNGNGGGDG
GGIFGGQNGF
Download sequence
Identical sequences A0A222SYP3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]