SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A229HA87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A229HA87
Domain Number 1 Region: 7-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-79
Family Protein kinases, catalytic subunit 0.0000000317
Further Details:      
 
Domain Number 2 Region: 512-573
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000301
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.016
Further Details:      
 
Domain Number 3 Region: 446-506
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000863
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A229HA87
Sequence length 670
Comment (tr|A0A229HA87|A0A229HA87_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:OXL33287.1} KW=Complete proteome OX=1945643 OS=Streptomyces sp. NBS 14/10. GN=B7755_15560 OC=Streptomyces.
Sequence
MEEPRRLGGRYELGSVLGRGGMAEVYLAHDTRLGRTVAVKTLRVDLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYVDGVSIPYIVMEYVDGSTLRELLHSGRKLLPERTLEMTV
GILQALEYSHRNGIVHRDIKPANVMLTRNGQVKVMDFGIARAMGDAGMTMTQTAAVIGTA
QYLSPEQAKGETVDARSDLYSTGCLLYELLTVRPPFIGDSPVAVAYQHVREEPQPPSTFD
PEITPEMDAIVLRALVKDPDYRYQSADEMRADIEAALEGQPVAATAALGAVGYGGEDQPT
TMLRSQDVGAQTSMLPPMRDDDGGFGYDERPDRRRGPEKKSNLSTILLVLAGILVLVGAI
FIGKEIFSGGKNSDNVDVPSLKGLTLSEARQQGENSDFKVKATGSPIFCDADKNTVCKQS
VEGEKAIERYGTVQLTMSKGPKPAAKVEVPDVINIQFESAKQQLEAKGFKVNKTTEESDQ
TTDKVIDQDPKGGKKVAPGTEITLTVARAQAKVTVPDVTTKKLADATSTLESAGLKVQST
EVENADVEAGTVISQNPQPNEQVLPNTTVTLTVAKAPAQQQNVAVPQLRGQKLKDAKKAL
EDAGLTVGTVSGSQNEDSRVLFSDPAEGQQVPKGQVVNLTTFDSGQGNNGGGDGGGDGGT
IPFGGPTGGP
Download sequence
Identical sequences A0A229HA87
WP_089507428.1.89855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]