SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A243DKK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A243DKK3
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.09e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A243DKK3
Sequence length 106
Comment (tr|A0A243DKK3|A0A243DKK3_BACTU) PTS lactose/cellobiose transporter subunit IIA {ECO:0000313|EMBL:OTY99393.1} KW=Complete proteome OX=475791 OS=Bacillus thuringiensis serovar subtoxicus. GN=BK754_04685 OC=Bacillus cereus group.
Sequence
MSDMQTPFALILHGGNARSAALEAIAFARQGDFGNAGEKMKLASEEISAAHRIQTDLIQE
EARGNHAEISLLLVHAQDHLMNAITVKELAEEFIALHKRVEEKVTV
Download sequence
Identical sequences A0A0J7GJY7 A0A243DKK3 A0A243HND5 A0A2J9B9V4 B7HDK5
405532.BCB4264_A0844 WP_001282173.1.10584 WP_001282173.1.14039 WP_001282173.1.45317 WP_001282173.1.47975 WP_001282173.1.63902 WP_001282173.1.73457 WP_001282173.1.73594 WP_001282173.1.7593 WP_001282173.1.76086 WP_001282173.1.81773 WP_001282173.1.90352 WP_001282173.1.97670 WP_001282173.1.99212 gi|218235708|ref|YP_002365579.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]