SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A243RLL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A243RLL0
Domain Number 1 Region: 7-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-79
Family Protein kinases, catalytic subunit 0.0000000347
Further Details:      
 
Domain Number 2 Region: 512-572
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000419
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 448-506
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000128
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A243RLL0
Sequence length 619
Comment (tr|A0A243RLL0|A0A243RLL0_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:OUC95698.1} KW=Complete proteome OX=569862 OS=Streptosporangium sp. M26. GN=CA984_17915 OC=Streptosporangium.
Sequence
MTQPRRLGDRYELDGVVGRGGMAEVYRARDIRLDRIVAIKTLRADLARDHIFQARFRREA
QSAASLNHPSIVAVYDTGEDVAGSAPVPYIVMEYVDGRTLRDLLRADRRLLPERAAELVD
GILRALDYSHRGGIVHRDIKPANIMITNNGDVKVMDFGIARAMADSAATMTQTAQVIGTA
QYLSPEQARGERVDARSDIYSTGCVLYELLTGQPPFTGDSPVAIAYQHVREDPIPPSQID
PEIPKWADAIVLKAMAKDPAHRYQSAGEMRADIQRAMSGIPMDAQTMALANNYGSATRTM
QTPGPGGPATQRTSAVPAYEYGTEEGGGRGERGRRRQQSNGNTAVKTAAWILVPLLVIGA
FIGVGYMFLSSPGDSDAANKIKIPALTSRTEAAATKALTDLGLTVKTVEKFDEESEKGTV
IETSPAAGTAVDKGAEVTLTVSKGVEKAEVPNVVNMTTDEAKAALEEAGFVPSVRTKASS
GPQGKVLETNPEAGKKAPKGSTVQIYVPKEAVEVPGVVNLTVNDAKRMLKEAGFKYKVVE
QESDLPEGTVLSQAPEAGAKLQQGTTITLVVSSGKAPQPTEQPTTEPTQEPPITEEPDPE
PTETEDPFFNEAPSDDLGG
Download sequence
Identical sequences A0A243RLL0
WP_086573817.1.23494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]