SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A249N4X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A249N4X1
Domain Number 1 Region: 17-134
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.93e-18
Family MarR-like transcriptional regulators 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A249N4X1
Sequence length 140
Comment (tr|A0A249N4X1|A0A249N4X1_LACRH) Uncharacterized protein {ECO:0000313|EMBL:ASY48552.1} KW=Complete proteome OX=1380361 OS=Lactobacillus rhamnosus DSM 14870. GN=N507_1377 OC=Lactobacillus.
Sequence
MTMKKQYLSASQSVNQFNRLFSPVSTADIPLNQQNLLFWMATDSTPRTPTNLAKEMHVTK
AAITKASGPLLERGLLDKQPDPEDCRSFKLVLSEAGEKAVEDLGPEYLGNLERLYNELGE
KKYLKLIKLLSQATGVTVKE
Download sequence
Identical sequences A0A249N4X1 C2JUV3 K8Q5Z5
gi|523521091|ref|YP_008207171.1| gi|523518134|ref|YP_008204216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]