SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A249WGX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A249WGX0
Domain Number 1 Region: 11-227
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.66e-35
Family Phosphate binding protein-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A249WGX0
Sequence length 229
Comment (tr|A0A249WGX0|A0A249WGX0_9ENTR) Amino acid ABC transporter substrate-binding protein {ECO:0000313|EMBL:ASZ55856.1} KW=Complete proteome OX=1134687 OS=Klebsiella michiganensis. GN=CKQ55_11770 OC=Enterobacteriaceae; Klebsiella.
Sequence
MIEHHDQKGYLRFAINLGNPVLTTLLPDGSPGGITVELAKKLAAESQREARFVTWPTAGQ
VVDAALQDRWDIAFLAIDPAREDKLRFTPSYVTIESSLMVKKESQIQSVQEMDRAGVVIN
VGKGAAYELYLIRTLQHATMRQYATSQEAIQAFINGEGDWVAGIRQPLEKAAQENPQFRV
LPDSFSQIHQAICVPRNATQHYEFICRRLSSWIADGTIAGMVSRHIGNS
Download sequence
Identical sequences A0A249WGX0
WP_014837087.1.18452 WP_014837087.1.21019 WP_014837087.1.67927 WP_014837087.1.6818 gi|397655289|ref|YP_006495991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]