SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A249WKS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A249WKS0
Domain Number 1 Region: 24-329
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.21e-97
Family Phosphate binding protein-like 0.0000000000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A249WKS0
Sequence length 331
Comment (tr|A0A249WKS0|A0A249WKS0_9ENTR) Proline/glycine betaine ABC transporter substrate-binding protein ProX {ECO:0000313|EMBL:ASZ57236.1} KW=Complete proteome OX=1134687 OS=Klebsiella michiganensis. GN=CKQ55_19355 OC=Enterobacteriaceae; Klebsiella.
Sequence
MRHTAILATALTALISTTAFAADLPGKGITVKPIQSTISEETFQTLLVSRALEKLGYTVD
KPSEVDYNVGYTSLASGDATFTAVNWQPLHDDMYAAAGGDKKFYREGVFVNGAAQGYLID
KKTAEQYHIKSIDQLKDPKIAKLFDTNGDGKADLTGCTPGWGCEAVINHQLDAYGLNNTV
THNQGNYAAMMADTIARYKEGKPVIYYTWTPYWVSDVLKPGKDVVWLQVPFSSLPGEQKD
IDTKLPNGMNYGFPVNTMHIVANKAWAEKNPAAAKLFSIMKLPIADINAENAMMHAGHGS
EADIQGHVDGWIKAHQQQFDGWVEEALAAQK
Download sequence
Identical sequences A0A068HGT1 A0A249WKS0 A0A2I8W9E3
gi|397659515|ref|YP_006500217.1| WP_014839294.1.18452 WP_014839294.1.20013 WP_014839294.1.21019 WP_014839294.1.6818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]