SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A250Y7U5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A250Y7U5
Domain Number 1 Region: 632-887
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-55
Family YWTD domain 0.00000142
Further Details:      
 
Domain Number 3 Region: 331-571
Classification Level Classification E-value
Superfamily YWTD domain 1.26e-50
Family YWTD domain 0.00000394
Further Details:      
 
Domain Number 4 Region: 935-1194
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-39
Family YWTD domain 0.0000429
Further Details:      
 
Domain Number 5 Region: 889-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1325-1363
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 1246-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000122
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 1287-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000367
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 9 Region: 588-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000559
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000754
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 11 Region: 1204-1257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000281
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A250Y7U5
Sequence length 1613
Comment (tr|A0A250Y7U5|A0A250Y7U5_CASCN) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} OX=51338 OS=Castor canadensis (Beaver). GN=LRP6 OC=Castoridae; Castor.
Sequence
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLIDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFVIINTE
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKHTGEGLREIHANIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PHKPFYQCACPTGVKLLENGRTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVKAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMAGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGTIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGNYVYWTDWQRRSIERVHKQSAEREIIIDQLPDLMGLKATNVHRVIGSSPCAEENGGCS
HLCLYRPQGLRCACPIGFELLSDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGGQGFTVVVSSVPNQNLEIQPYDLS
IDIYSRYIYWTCEATNVITVTKLDGKSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCVTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCIGKHKKCDHSVDCSDKSDELECYPTEEPAPQATSTVGSVIGV
IVTIFVSGTVYFICQRMLCPRMKGDGESMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGPYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A250Y7U5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]