SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A255UID0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A255UID0
Domain Number 1 Region: 8-234
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.79e-59
Family Alanine racemase-like, N-terminal domain 0.0000147
Further Details:      
 
Domain Number 2 Region: 226-354
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 5.58e-43
Family Alanine racemase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A255UID0
Sequence length 356
Comment (tr|A0A255UID0|A0A255UID0_9GAMM) Alanine racemase {ECO:0000256|HAMAP-Rule:MF_01201} KW=Complete proteome OX=2024618 OS=Acinetobacter sp. BS1. GN=CIL08_08065 OC=Moraxellaceae; Acinetobacter.
Sequence
MRQATVYIDRNALQYNLNRVKQLATNSKIVSMVKANAYGHGIKDCLAALNASDAFGVACL
QEGLEIRELGFQQPVTLIEGVFSEDEMPIAIKQKFECIIHHQQQFEWLIKHKQAYINQGL
KVWVKLNSGMNRLGFKNPEIIEVIKTLKSEGFTCVLAMHFANADVDHPLNEQQKQQFLQV
KQACDPVLASCCNSAAIYKWPELHFDYVRPGIMLYGASPFADQTVHDLDLKPVMTFSAEV
IALNHIQTNEHVGYGSTFCATQAMDIAIVSIGYGDGYPRAYIKPNYVAIDKQPCAVVGRV
SMDMIAIDVTGMKVKLGTPVELWGPHRLVDDVADANGTIGYELLCRLSNRPTRKST
Download sequence
Identical sequences A0A009HFG6 A0A009N4D1 A0A010UZZ2 A0A011JZI3 A0A062DWT4 A0A062H1V5 A0A062LAL1 A0A241Y406 A0A255UID0 K9CLB9
WP_002119694.1.10172 WP_002119694.1.10577 WP_002119694.1.13806 WP_002119694.1.15127 WP_002119694.1.15324 WP_002119694.1.16785 WP_002119694.1.17255 WP_002119694.1.19026 WP_002119694.1.21157 WP_002119694.1.21163 WP_002119694.1.22540 WP_002119694.1.24130 WP_002119694.1.24272 WP_002119694.1.27093 WP_002119694.1.28356 WP_002119694.1.28666 WP_002119694.1.32082 WP_002119694.1.32712 WP_002119694.1.33112 WP_002119694.1.33990 WP_002119694.1.34068 WP_002119694.1.35862 WP_002119694.1.3591 WP_002119694.1.38165 WP_002119694.1.38536 WP_002119694.1.3878 WP_002119694.1.39054 WP_002119694.1.40405 WP_002119694.1.41195 WP_002119694.1.41946 WP_002119694.1.42636 WP_002119694.1.44199 WP_002119694.1.44502 WP_002119694.1.44518 WP_002119694.1.44895 WP_002119694.1.45253 WP_002119694.1.45892 WP_002119694.1.46031 WP_002119694.1.47248 WP_002119694.1.47968 WP_002119694.1.54053 WP_002119694.1.5629 WP_002119694.1.57061 WP_002119694.1.59296 WP_002119694.1.60333 WP_002119694.1.61872 WP_002119694.1.61879 WP_002119694.1.62133 WP_002119694.1.65610 WP_002119694.1.66414 WP_002119694.1.68333 WP_002119694.1.68495 WP_002119694.1.69405 WP_002119694.1.71795 WP_002119694.1.72314 WP_002119694.1.74047 WP_002119694.1.74342 WP_002119694.1.75893 WP_002119694.1.77264 WP_002119694.1.77640 WP_002119694.1.8016 WP_002119694.1.83027 WP_002119694.1.83233 WP_002119694.1.8589 WP_002119694.1.86200 WP_002119694.1.89761 WP_002119694.1.90720 WP_002119694.1.93042 WP_002119694.1.9318 WP_002119694.1.93557 WP_002119694.1.9494 WP_002119694.1.96439 WP_002119694.1.97698 WP_002119694.1.98297 WP_002119694.1.98696 WP_002119694.1.98783 WP_002119694.1.99031 WP_002119694.1.99121 HMPREF0013_01609T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]