SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A261Y0L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A261Y0L9
Domain Number 1 Region: 1997-2127
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.02e-33
Family Reductases 0.00039
Further Details:      
 
Domain Number 2 Region: 810-984
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 4.39e-33
Family Ran-binding protein mog1p 0.0012
Further Details:      
 
Domain Number 3 Region: 1909-2006
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.05e-22
Family Ferredoxin reductase FAD-binding domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A261Y0L9
Sequence length 2156
Comment (tr|A0A261Y0L9|A0A261Y0L9_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:OZJ04152.1} OX=1938954 OS=Bifiguratus adelaidae. GN=BZG36_03120 OC=Endogonales incertae sedis; Bifiguratus.
Sequence
MQALSPNSTRLRSMGRQWHSKNGSALESRKKDSGPPMAKADLLARHTNDPPSLILHLYAT
YFKFENQDGFFSYQSPFKDFLRYIKDCRLPPDLIDVFNQSRCKYYEGDSGCLIVEIRDHR
SKSSPHIMNGEERRMDTRLSNGADGDAPKRIVLRPSSEALWTDLCLLSEASMEQWTEAMA
LEVEAKILLATQDDICLDPSIDVMRVSNAVAYLQSAPRKKRKRKMNSTEREEELEKKKES
DKLMTTKDERAQRAFPFQPSFGDIAFVQEWRAKKARSDAEPLLCLGSQSPEAKRLTRGLD
TQITTKCEYSIAVDTGRRNGTNEPFQLPDGRRCLRTLRFEREAGGQKIYTTLAIYQAGNE
FRAVLRRGSAPDTAIKGGTLDFPIGPDFLLNSFITHFKNFYRLDNKLVQDIDPLGQQAAA
MSKPLQAQMAQLQQAQQLQQLQHMQQPAAAVAAAVSSANVRTPQMTAQNMSASPVAPSPQ
ILNKLPNGSQAPTMGTPQMANMAFNMQHMQNRMNAMSGAASSAPMTAAAQTSAGQINMAT
LTSQNWTLPQLQQLAASGQVSQSVLKHLLATYTAQQQHAQQQAQAAQTMQLNQQQPQQQQ
QPGQIRPQQFNMAAQANQASINANIAGLTQQQQNAMHIQRQRMLAGMQAGANINGQPLNL
QNMSPQQQQLLQAAILQRNIAAAGRGRGNFSPQQLAQLNQLRLQQQMAAMGRGNANPAAT
AAALAQAQAQAQAQAQAQAQAQAQAQGRGRGMIPQAAFFANMTPQMRAQLAAMNGGTLPN
NMMAMQQLLLQQQQLQQQQQQHQTSMQQIAYIPPEFTDISTIREIPDSQEVFANAAYDQS
IIIELLEQQSDCVDGDLDARLHFSQIADDNEATSSEITDIKRVGPEQAPKLPADKVLITM
VEGTQHVSKFRETKADAVNVLRVLMAIVRIPHVKTDLVISFNVPIAFGQGSSSAQLASQQ
LGGVEEALQIFHRFMQSLEIKDWGFTRHGKGTPKGTETPVQSPKSPTPTTKPNDTVSNDT
EVESVNKVQEVSKVTLPRKDEKKRSVRRSLASACWLIADTLLGTLHILRPFLSLALALLL
IAYFIQYIASMLPPHFSTYLCPPFISRFLPFCDNSDIYIPDFSTLVNKQVDLYGSMNSQI
HPDSISAVELKKVELATSDLRMMVKFSALGCAPLLDEQLGSYIVQSRELGRQVQILQART
KGTIDNLITYNTYMLRGLGEAQDRKSPSSLRGLRELYKTTMSYVEGDVRRLILAVQETLG
GLDNLESTLGSIHEITAQELTLQRYEHNKLLSELWTIVGGNRLQRAEFKDNFCLLENFDH
QRIDATQRLKILLHRLTAFQLDLEELRETLNRPIMEDAQSEVPIIMLPLEIQIENVAKGI
ERLRETKVLERKTIEAIPTGIELRRLCPLKSIWSVDLAFLLRNYVEDFTYYTSFLGSRRE
YKKDKFYQETYDEDQKRVDKLFAVAKAANVHIVRMILPLDDYKRFLYCKQFAIISLVNIR
LLQCELCLRNPVDAQRRAQRKRELKKQQDERKRQRELVSELRDTGKASKEVERLEQLARQ
RQLDKHEMEKLKKFKLELAKHKRNKEAESSGAKENKDEIDPRLSIYYDPVFNPYGAPPPG
KKQEYRTSLDAKADSDKDESEAELGAEQDEEEGSGNVPMPGKDDQSSEDEFSDEDDIPLD
EIPLPDGPPPQRLRSPYPSNGVYQPQYAFSGPPPGVPAHASYPYPPHHQSIPPQYSSAAE
PTYPTPPPPAPLIKSSQYAHFQSAATTTGPSPAIQSPTYSKPKAYAPNAVIAAAPVVRDL
QKELTTMVPASLRRKGLTKAGKPSKSLPKVNAAPDLGEGSDAIPTKDPIVPPPDKAKDGA
SSKIQEEYDQFMKEVEGLITFLFGTVTTASLLAWVYSTRSDQDVGRLLEHKYTPLKLVHT
QPVTPNTTLFRLQLSHPPLHFPPISSIHVKDSSMQIMRPYTPVNDPVKDGYIDLLVKRYK
DGTMSNMLHNLALGQSVEVCGPVREYDHQQGSKREIGMIAGGTGITPMYQLIRSVLNQGD
DRTKISLIYANRTEQDIILRKELDQMAQLHPQRFKVYYTLEEWDQGWPFGHGYVSKAMIE
RMMPSAALGKDTAILVSGPDGMIDAVAGPRGPYMSQGKVGGLLARQGYQEHQVWKL
Download sequence
Identical sequences A0A261Y0L9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]