SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A286JAK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286JAK9
Domain Number 1 Region: 13-483
Classification Level Classification E-value
Superfamily ALDH-like 3.93e-175
Family ALDH-like 0.0000000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A286JAK9
Sequence length 484
Comment (tr|A0A286JAK9|A0A286JAK9_DELAC) Succinate semialdehyde dehydrogenase {ECO:0000313|EMBL:SOE39466.1} KW=Complete proteome OX=80866 OS=Delftia acidovorans (Pseudomonas acidovorans) (Comamonas acidovorans). GN=SAMN05216519_5550 OC=Comamonadaceae; Delftia.
Sequence
MPLALRDPSLLKNLCLIDGQWLAADDGSRIDVHNPATGEAVGHVPRMGEAETQRAIAAAE
RAFALWKQQTAEARARLLQRWFELMMENQEDLALIMTSEQGKPLAESRGEIAYAASYVQW
FAEEARRIYGSTVPAPWADKRIIVTKEPVGVCAAITPWNFPAAMITRKVAPALAAGCTII
VKPAQQTPLSALAMAELAQRAGIPEGVFSVITGSSRAIGGVLTASMAVRKLTFTGSTEVG
RVLAEQCAPTLKKMSLELGGNAPFIVFDDADLDAAVEGAMASKYRNTGQTCVCANRLLVQ
DGVYDAFMARLKVAVQALKVGNGLEAGVGQGPLIDQAAVDKVEELVADAVKNGAEVVLGG
KRHALGGTFYEPTILANATDRMRIAREEVFGPVAPVFRFKTEEEAIRMANDTEYGLAAYF
YARDVGRVWRVGEALEYGMVGINSGIISTAVAPFGGVKQSGMGREGGAAGIEEYLSTKYL
CMGH
Download sequence
Identical sequences A0A286JAK9 A9BQP4
398578.Daci_0100 gi|160895549|ref|YP_001561131.1| WP_012202039.1.82428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]