SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A286XJR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286XJR1
Domain Number 1 Region: 690-836
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1017-1115
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.51e-30
Family Ras-binding domain, RBD 0.0008
Further Details:      
 
Domain Number 3 Region: 219-370
Classification Level Classification E-value
Superfamily PH domain-like 1.06e-21
Family Phosphotyrosine-binding domain (PTB) 0.0091
Further Details:      
 
Domain Number 4 Region: 13-98
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-19
Family PDZ domain 0.0097
Further Details:      
 
Domain Number 5 Region: 962-1031
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000599
Family Ras-binding domain, RBD 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A286XJR1
Sequence length 1431
Comment (tr|A0A286XJR1|A0A286XJR1_CAVPO) Regulator of G protein signaling 12 {ECO:0000313|Ensembl:ENSCPOP00000025553} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=RGS12 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MMYRAGEPVKRPPLGPVPPRLRSVEVARGRAGYGFTLAGQAPCVLSGVIRGSPADFVGLR
AGDQIFTINEINVKKASHEDVVKLIGKCSGVLRLVIGEGAGHPEACSSDDEGGLCEGKGW
LRPKLDSKALGINRAERVVEEMQSGGIFSMIFENPSLCMSTPEPSQGKQRSLSESASVRL
EGSPNAVQTGLLSKEELVRVIHDDSVFSAGPENLDSFALDASILNVAMVVGYLGSIELPS
TSCNLESDSLQAIRGCMRRLRAEQKIHSLVTMKVMHDRVLLCSDKACVVAEYPAEKLAFS
AVCPDDRRFFGLVTMQTNDDGSLAQGEEGALRTSCHVFMVDPDLFHHKIHQGIARRFGFM
CTADPDTSGCLEFPASSLPVLQFISILYRDMGEFIEGVRARAFLDGDADAHQNNSTSSNS
DSGIGNFNQEEKSNRVLVVDLGGGLSRHGPGSSASWEGAGARSSQSWAASWSRSFCHSPE
GCASFEAGPQADRLRDLSKHLGPASHTEGTPASLWSSVPPSKRGSASTSCGLSQRWLPVH
VLQEWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSFMQAPLSAQKRD
WARKAFGMQNLFGPSRNVRRTKEDKKGSKFGRGIGLAQTSQRSSARRSFRRSKRFSITRS
LDDLESATVSDGELTGADLKDCVSSNSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQ
DPVGIRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSHRAREIFSKFLCSKATTP
VNIDSQAQLADDILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECILAEVEGRAL
PDAQQVPSSPASKHSIGSDHSSTSTPKKLSGKSKSGRSLNEDAGDEDSEKKRKGAFFSWS
RSRSTGRSQKKKEPGDHGQDTLPTNGGLCRRRESQGSVSSAGSLDLPEACRTLVPEKDKA
VKHCCIYLPDGATCVVAVKSGFSIKEILAGLCERHGINGAAVDLFLVGGDKPLVLHQDSS
ILASRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGSLLVRLSG
EKEPLDLGAPISSLDGQRVVLEERDPARGRAPTDKQKGALAKPSAAASSRPRDRSATGEE
RTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSN
RADDQRGLLTKEDLVLPEFLRLPPGSTKLPLCTLAAGKGFSKRPETTGHSREKASLPSDS
PATSPGSTQSTSSAQSPGSAQSPGSAHSPSGPRGASPLGQKVQEGPTQVWRRRQSQEVED
GGIQTEDESRADLTLVGEGDISSPNSTLLPPPPSPQDAPGPLRPGGRARGSQGLPVNRIF
DVDLAAGMAPRVWPGPRRARPMRPPASDCPGQSPSPGEPKAKLSTHHATFV
Download sequence
Identical sequences A0A286XJR1
XP_013013129.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]