SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A286ZU56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286ZU56
Domain Number 1 Region: 15-121
Classification Level Classification E-value
Superfamily Ribosomal protein L20 2.78e-37
Family Ribosomal protein L20 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A286ZU56
Sequence length 149
Comment (tr|A0A286ZU56|A0A286ZU56_PIG) Mitochondrial ribosomal protein L20 {ECO:0000313|Ensembl:ENSSSCP00000035117} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=MRPL20 OC=Sus.
Sequence
MVFLTVPLWLRSRVTDRYWRVQEVLKHARHFRGRKNRCYRLAVRAVTRAFVKCTRARRLK
KRSLRTLWINRITAASQEHGLKYPAFIINLIKCQVELNRKVLADLAIYEPKTFKSLAALA
KRRREEGFAAALGDGKEPDGIFSRVVQHR
Download sequence
Identical sequences A0A286ZU56
ENSSSCP00000003630 4v19_U 5aj4_BU 6gaw_BU 6gb2_BU ENSSSCP00000003630 XP_003127555.3.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]