SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A287ADT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287ADT1
Domain Number 1 Region: 555-810
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-54
Family YWTD domain 0.00000581
Further Details:      
 
Domain Number 2 Region: 254-484
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-50
Family YWTD domain 0.00000262
Further Details:      
 
Domain Number 3 Region: 857-1116
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-40
Family YWTD domain 0.0000719
Further Details:      
 
Domain Number 4 Region: 1245-1283
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 1207-1242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 1167-1205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 7 Region: 813-864
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000154
Family EGF-type module 0.03
Further Details:      
 
Domain Number 8 Region: 510-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000289
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 9 Region: 143-203
Classification Level Classification E-value
Superfamily YWTD domain 0.00000034
Family YWTD domain 0.0033
Further Details:      
 
Domain Number 10 Region: 209-251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000186
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1124-1176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000215
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A287ADT1
Sequence length 1519
Comment (tr|A0A287ADT1|A0A287ADT1_PIG) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSSSCP00000042172} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=LRP5 OC=Sus.
Sequence
MSKHTWSDLYYVAKASGLDRPACPQLIVTSGGFVPATFLLSSPWGALPVVTTLATGWTGG
SWMCRGARVTLRGGGGRPAGSARCPASLAEGSWGAPARSHAASSQLLGSGDRCDEGRPSG
LGPPWGPPDGASLRPDPCRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEK
RKEILSALYSPMDIQVLSPERQPYFHTRCEEDNGGCSHLCLLSPREPYYACACPTGVQLQ
GNGQTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWT
DDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR
KILVSEDLDEPRAIVLHPVMGLMYWTDWGESPKIECAHLDGQERHVLVNTSLGWPNGLAL
DLQEGQLYWGDAKTDKIEVINIDGTERRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIER
VHKVKASRDIIIDQLPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPRATKCGCPIG
LELLSDMKTCIVPEAFLVFTSRAAIHRISLDTNNNDVAIPLAGVKEASALDFDVSTNHIY
WTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQ
FRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNGMTLVDKVGRANDLT
IDYADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIER
ADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAVPSGHRCSCAS
HYTLDPSSRNCSPPTTFLLFSQKCAVSRMIPDDQHSPDLILPLHGLRNVRAIDYDPLDKF
IYWVDGRQNIKRAKDDGTQPFVLTSPGQSQSPDRQPHDLSIDVYGRTLFWTCEATNTINV
HRLNGDAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTG
LIRPVALVVDNALGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGKHLYWI
DRQQQMIERVDKTTGDSRTRVQGRVAHLTGIHAVEDISVEEFSAHPCARDNGGCSHICIA
KGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQS
DEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAVCLPNQFRCASGQCVL
IKQQCDSFPDCIDGSDELMCEITKLPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRV
VCQRYAGATGPFPHEYVSGTPHVPLNFIAPGGSQHGPFPGISCSKSMMSSVSLMGGRAGV
PLYDRNHVTGASSSSSSSTKATLYPPALHHPRHGAPDDALQYRRVRQRLQRQPLEGQQVL
PGFELGLRPLPTPAHAAQPVPVGGGQLPAFASHGEELLPPLPAPTVPLHGLVLTSAGPPR
PLCARVNSFKYEQRKNYIL
Download sequence
Identical sequences A0A287ADT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]