SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A287BT12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287BT12
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000377
Family Growth factor receptor domain 0.0038
Further Details:      
 
Domain Number 2 Region: 187-231
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000262
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A287BT12
Sequence length 244
Comment (tr|A0A287BT12|A0A287BT12_PIG) WNT1 inducible signaling pathway protein 2 {ECO:0000313|Ensembl:ENSSSCP00000059299} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=WISP2 OC=Sus.
Sequence
MGGTAQTLILAFSLLCLLSKVCAQLCPTPCACPWPPPRCPPGVPLVLDGCNCCRVCARRL
GEPCDHLHICDSSQGLVCQLGAGPGSRGAVCLWGEDDGSCEVNGRLYRDGETFQPHCRIR
CRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVPGKCCPEWVCDPQPLPARGPQFSGLVA
PPVPGIPCPEWSTAWGPCSTTCGLGVATRVSNQNRFCRLETQRRLCLPGPCPPARGHSPR
NSAF
Download sequence
Identical sequences A0A287BT12
ENSSSCP00000007862 ENSSSCP00000007862 XP_003134500.1.46622 XP_003134501.1.46622 9823.ENSSSCP00000007862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]