SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A287BTN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287BTN6
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-54
Family YWTD domain 0.00000581
Further Details:      
 
Domain Number 2 Region: 180-410
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-50
Family YWTD domain 0.00000262
Further Details:      
 
Domain Number 3 Region: 783-1042
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-40
Family YWTD domain 0.0000719
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-28
Family YWTD domain 0.0000829
Further Details:      
 
Domain Number 5 Region: 1171-1209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1133-1168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1093-1131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 436-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 9 Region: 739-790
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family EGF-type module 0.03
Further Details:      
 
Domain Number 10 Region: 135-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000158
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1050-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000745
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A287BTN6
Sequence length 1343
Comment (tr|A0A287BTN6|A0A287BTN6_PIG) LDL receptor related protein 5 {ECO:0000313|Ensembl:ENSSSCP00000059615} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=LRP5 OC=Sus.
Sequence
MYWTDWGETPRIERAGMDGSSRKVIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANL
DGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGEKRKEILSALYSPMDI
QVLSPERQPYFHTRCEEDNGGCSHLCLLSPREPYYACACPTGVQLQGNGQTCKAGAEEVL
LLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDG
SGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAI
VLHPVMGLMYWTDWGESPKIECAHLDGQERHVLVNTSLGWPNGLALDLQEGQLYWGDAKT
DKIEVINIDGTERRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDIIIDQ
LPDLMGLKAVNVAKVVGTNPCADRNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIVPE
AFLVFTSRAAIHRISLDTNNNDVAIPLAGVKEASALDFDVSTNHIYWTDVSLKTISRAFM
NGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPR
SLALDPTKGYIYWTEWGGKPRIVRAFMDGTNGMTLVDKVGRANDLTIDYADQRLYWTDLD
TNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQG
HLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAVPSGHRCSCASHYTLDPSSRNCSPP
TTFLLFSQKCAVSRMIPDDQHSPDLILPLHGLRNVRAIDYDPLDKFIYWVDGRQNIKRAK
DDGTQPFVLTSPGQSQSPDRQPHDLSIDVYGRTLFWTCEATNTINVHRLNGDAMGVVLRG
DRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVALVVDNALG
KLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGKHLYWIDRQQQMIERVDKTT
GDSRTRVQGRVAHLTGIHAVEDISVEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHL
VLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFP
CARGQCVDLRLRCDGEADCQDRSDEADCDAVCLPNQFRCASGQCVLIKQQCDSFPDCIDG
SDELMCEITKLPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGATGPFPH
EYVSGTPHVPLNFIAPGGSQHGPFPGISCSKSMMSSVSLMGGRAGVPLYDRNHVTGASSS
SSSSTKATLYPPGHTRGRCGPAG
Download sequence
Identical sequences A0A287BTN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]